Coprinopsis cinerea: CC1G_04940 Help Entry CC1G_04940        CDS       T01275                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism cci  Coprinopsis cinerea Pathway cci03083   Polycomb repressive complex cci04111   Cell cycle - yeast cci04120   Ubiquitin mediated proteolysis cci04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CC1G_04940    04120 Ubiquitin mediated proteolysis     CC1G_04940   09126 Chromosome    03083 Polycomb repressive complex     CC1G_04940  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CC1G_04940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cci04131]     CC1G_04940    04121 Ubiquitin system [BR:cci04121]     CC1G_04940    03036 Chromosome and associated proteins [BR:cci03036]     CC1G_04940 Membrane trafficking [BR:cci04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CC1G_04940 Ubiquitin system [BR:cci04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      CC1G_04940    Cul7 complex      CC1G_04940 Chromosome and associated proteins [BR:cci03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CC1G_04940   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CC1G_04940 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6017764 NCBI-ProteinID:  XP_001841096 UniProt:  A8PFM3 LinkDB All DBs Position 2 AA seq 154 aa AA seqDB search MTELILQTDSGYLLVVDANDARESLTLRHTLEDSAYSGEVFVIPSSTDDALREAFRYIRH HRGHNCSPVNPGDPYCPFDQAFIERSTQQVLELLEVADFLNIVPLLDLIGFKLASIAVSV PMTDFVKFFNLASHDDPEQMYIRVETGGFKLLHD NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgacagaacttatactacaaacagattccggctatctgcttgtcgtcgacgccaatgac gctcgggaatcccttacccttcgccacaccctcgaagactccgcttattctggcgaggtt tttgttattccatcgtccacagacgatgccttgcgtgaggcattccgctatatacggcat catcgcggacataactgttctcccgtgaatcccggagatccctactgcccattcgaccaa gctttcatcgagcggtccacccagcaagtattagagttgctcgaggtggccgatttcttg aacattgtcccgttactagatttaattggatttaaactcgccagtatcgctgtgtctgta cctatgacggactttgtgaagtttttcaacctcgcctctcatgatgatcccgagcaaatg tatatcagggttgaaactggtggatttaagcttttgcacgattga

DBGET integrated database retrieval system