KEGG   Clostridium carboxidivorans: Ccar_05755
Entry
Ccar_05755        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05755
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05755
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05755
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH FDX-ACB T7SS_ESX_EspC Sec34
Other DBs
NCBI-ProteinID: AKN30352
UniProt: C6PPN5
LinkDB
Position
1343559..1345259
AA seq 566 aa
MNFIKNLKIVHKISLLSASFFIFLLLLGVTSILQVSKVNYGIKQLSESRLTPIVELEKAK
SNIEYIRTKSSSLMDATDDNTRKTVEADLTTHITAVDKALEKYKSNSEYKTLLDNYDKFI
SAEEAFIKTAESGNITKQGPPTEAINLDKAKISVVASFDEIINKHVASANSTYEMSKKVF
GSTMIIIISLVAICLIITGILSLIIIKETVVPIKKVTERLKEISNNNGDLTQRIGYESKD
EIGELSSNFDMFIDKLHVIIKEIYGSANTISASSEELSMATKTTAESLDTISSTVAEIAS
STSDGAAVSEETSAHLAEVARFTEATSLATKNTTSNSKRAKRAAEDGSIKISEIVLSITD
IADSSKQVSLMISELDNSSKKIGDIIQIITGISEQTNMLALNAAIEAARAGEAGKGFTVV
ADEIRKLADESNSAAKQISDLIKENQLKSASAVSSVSKVEEKVSLGVNKASEVGQIMQNI
IENTQEIVSEVEEIDKSTETQVEGTKEMEMAINTIAANSSEIAAGTENISASIEEQLSIV
NEVERTTENLSEMSRKLKEIVSGFRV
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaattttattaaaaacttaaaaattgtacataaaatcagtttactttctgctagtttc
tttatttttcttttattactaggtgttacttcaatattacaagtatcaaaggtcaattat
ggaattaaacagttaagtgaatcaagattgacaccaattgtagaattagaaaaagccaaa
tccaatatagagtatattagaactaaatctagttcattaatggatgcaacagatgataac
acaagaaagactgtagaagctgatcttacaactcatataactgctgtagataaagcttta
gaaaagtataaaagtaatagtgaatataaaaccttacttgataactatgataaatttata
tcagctgaggaagcttttataaaaacagctgaatctggaaatattacaaagcaaggacct
cctactgaagcaattaatctcgataaagccaaaatttctgttgtagcatcttttgatgaa
attataaataagcatgttgcatcagcaaattccacttatgaaatgagtaaaaaagttttt
ggaagtacaatgattataataatatcacttgtagctatatgtttaattataacaggaatt
ttatccttgattataattaaagaaactgttgttccaattaaaaaggttactgaaagatta
aaagaaatttccaataataatggagatttaactcaaagaataggttatgaaagtaaagat
gaaataggagagcttagttcaaattttgatatgtttattgataagctgcatgtgattatt
aaagaaatatatggttctgccaatactatttcagcttcaagtgaagaattaagcatggca
acaaagactactgcagagtcacttgatactatatcaagcactgttgcagaaatagcatcc
agcacttctgatggagcagctgtttccgaagagacttcagcccatcttgcagaagttgca
aggtttactgaagcaacttctttagcaactaaaaatactacaagtaatagtaaaagagca
aaaagagcagcagaggatggttcgattaaaatatctgaaattgttttatctataacagac
atagcagattcttctaaacaagtatctcttatgataagtgaattagataattcttcaaaa
aagataggagatattattcaaattataacaggtatatcagaacagaccaatatgctagca
ctaaatgcagcaatagaagcagcacgtgctggggaagctggaaagggctttactgtagta
gctgatgaaataagaaagcttgcagatgaaagcaattctgcagctaagcaaatatctgat
ttaataaaagaaaatcagttaaaatctgcttcagctgtaagttcagttagtaaagtagaa
gaaaaagtatctcttggagttaacaaagcttctgaagttggacaaatcatgcagaatata
atcgagaatacacaagaaattgtaagtgaggtagaagaaattgataaatctacagaaact
caagttgaaggtaccaaagaaatggaaatggctataaatactatagctgctaactcaagt
gaaatagcagcaggaactgaaaatataagtgcaagtattgaagaacaattgagtattgtg
aatgaagttgaaagaactacagagaatttatcagaaatgtcaagaaaattaaaagaaata
gtttctggatttagagtataa

DBGET integrated database retrieval system