KEGG   Clostridium carboxidivorans: Ccar_08420
Entry
Ccar_08420        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08420
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08420
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08420
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF1664 UPF0242 DUF1993 DUF1240
Other DBs
NCBI-ProteinID: AKN30862
UniProt: C6PN34
LinkDB
Position
1958574..1960568
AA seq 664 aa
MKSIRSKLILAISSTCIILILISSIVSYAISYKTITKQSSEQALIASEKYSELINGWLDG
QAKILDETDYAIENLGNFDENGISNYLQSKLKLNSNITDIYIGMTNKKMIDGSGWNPPAD
YDCTQRSWYKLAMEKKSLIYTPPFLDQTTKKMVVSIAKPVTKNGQVIGVISTDINLDLLT
DTIKKASPINNSYSYLMDSSNNIIIHPNKDFQPKDKELKNLSNVFDGKYMSITSKNSFVL
KDYDGTNRYFVSSKVKASNWIIGFAIPTKEFNKPLNALVIYAVIILIASLIFSLIFASYL
SSKLAGPISLITKDINKLKDFDFENDDDECNKALKYKDEIGIIAHSVLNLKQELRKIVED
LKNSSDSILKYSNNVSSSVEQTVMSITDVAKATSQLAEGSVEQAKESETGLKKLNNLADK
INTIVLKTNEVKKYSYLTNDVNKKGMSSILDLSSKLEQNNDASQKVAENINILSKKSESI
GAIVNTIESIAEQTNLLALNAAIEAARAGESGKGFAVVADEVRNLSEETAASTKEISNMI
KEILDEINSTQLNMVNAEKIIKEANNSMAESEKSFKTIEDSINKMITYIEELTSEIDEVE
ENKEIAVKSIEGISVISEEAAASTEEVSASMEEQSSAMEIISSNMEELKNITNSLNEIVA
KFKL
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaaaagtataagatcaaaactaattctagcaatttcttcaacctgtattatacttatt
ttgatttcctctatagtaagctatgctatatcatataagaccattaccaaacaatcaagc
gaacaagcattaattgcttctgaaaagtattcagaattaatcaacggatggcttgatgga
caagcaaaaatacttgacgaaactgattatgcaatagaaaatctaggtaattttgatgaa
aacggtatatcaaattatcttcaatctaaattaaaattgaattctaatattactgatatt
tatattggaatgacaaacaaaaaaatgatagatggttctggttggaatcctcctgcagat
tatgattgtactcaaagaagctggtacaaattagccatggaaaagaaaagtctaatttac
acaccacccttcttggatcaaactacaaaaaaaatggtagtttctatagctaaacccgtg
acgaaaaatggacaagtaataggtgttattagtacagatattaatttagatctccttaca
gatacaataaaaaaagcttcacctataaataatagttattcttacttaatggattcaagc
aataatattattattcatccaaataaggattttcaacctaaagataaagagcttaaaaat
ttaagtaatgtatttgatggtaaatatatgtcaattacttctaaaaactcctttgtctta
aaagattatgatggtacaaatagatattttgtgtcatcaaaggtaaaagcttcaaattgg
attataggatttgctatacctactaaagaatttaacaaacctctaaatgctttagttata
tatgctgttatcatattaatagcgtctttaattttttctttaatatttgcttcatatctc
agcagcaaattagctggccctatatccttaataacaaaggatatcaataaattaaaggat
tttgattttgaaaatgatgatgatgaatgcaataaggcattaaaatataaagatgaaata
ggcattattgctcattctgtattaaatttaaaacaagaattaagaaaaattgttgaagat
ttaaaaaatagttcagatagcatattaaaatactcaaacaatgtgtcctcttctgtagaa
caaacagttatgtctattacagatgtagctaaagctacaagccaattagcagaaggttca
gttgaacaagctaaagaatcagaaacaggacttaaaaagttaaataacttagcagacaaa
ataaatactatagtattaaaaactaatgaagtaaaaaaatattcatatttaactaatgat
gttaataaaaaaggtatgtcttccattttagatttatcttctaaattggaacaaaataat
gatgctagccaaaaagtagctgaaaatattaatattttatctaaaaaatccgaatctatt
ggtgctatagtaaataccatagaatccatagctgaacaaacaaatttgttagctttaaac
gctgctattgaagctgcaagagctggagaatctggaaaaggatttgcagttgttgcagat
gaagttagaaatttatctgaagaaacagctgcttctacaaaagaaatttctaatatgata
aaggaaattttagacgaaatcaattcaactcaattaaacatggtaaatgctgaaaaaata
atcaaagaagctaataattctatggctgaatctgaaaagtcgtttaaaacaattgaagat
tcaataaacaaaatgataacatacattgaagaacttacatctgaaattgatgaagttgaa
gaaaataaagaaattgccgttaaatccattgaaggtatatccgtaatatctgaagaagct
gctgcttctactgaagaagtttcagcttctatggaagaacaatctagtgctatggaaatt
atatcttctaatatggaagaactaaaaaatattacaaatagtttaaatgaaatagttgct
aagtttaaactataa

DBGET integrated database retrieval system