KEGG   Clostridium carboxidivorans: Ccar_24005
Entry
Ccar_24005        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24005
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24005
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_24005
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Peptidase_S49 DUF3215
Other DBs
NCBI-ProteinID: AKN33722
LinkDB
Position
5343696..5345762
AA seq 688 aa
MNKKAIGIKGRILLSSMVVLLITLVSISSILIYEINKKSHEDYFANSKEQMKIVSQAINI
FYDQIDKNIDMLTTNPSVMMADNSITTYKNTTQDTPMKPSAKAGIEQEIYKVFEQYANSH
KGTSYVYLGTEDGGYIQWPEESLPAGFDPSKRPWFNDAMNKKGSVIRTAPYSYKSQLLTS
NARTITDKNGKIIGAIGIDVQQTNISDMLNKMKIGKTGYSMIVHSNGLIMADGKNPKNNF
KKVGEVGINGLDKLLAKDLKSFDVVVDGEKYIVNPYKVEGTDWILASFMTEKELGAGAKE
IVNIMIFSAGAMLILATILFNFLSSSITKPILAVTKRVQDFANLDFSVDEKADTLKYLNR
KDEAGDMIRAFVSMRENVSEFIVKTAHSTEKVAASSEELTATSEQAATASNEVSKAIEEI
AKGATDQAKDTQMAAHNVEDLGNLLEQDLNYIEELNVAAVEIERQKSEGFLILKELVEKT
KKNNDSANNVYHIIMSNNESAEKIENASTMIQSIADQTNLLALNAAIEAARAGDAGKGFA
VVADEIRKLAEQSNNFTNDIKTVITGLKIKSQNAVDLMQQTKQIIEEQASSVGETEGKFE
GIAEAIDSIKSVVNKLNNSANLMTENKNKIIELTQNLSAISEENAAGTEQASSSMQEQVN
TIEQIAIAGESLATISEELRVLVDKFKV
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgaataaaaaggctattggaataaagggaaggattttactatcttcaatggtagttctt
ttgataaccttagtaagtattagtagtattctaatttatgaaattaataaaaagtctcat
gaagattattttgctaattctaaagaacaaatgaagatcgtttctcaagcaattaacatt
ttttatgatcaaattgacaaaaatattgatatgctaacaacaaatccatcagtaatgatg
gctgataacagtattacaacctataaaaatacaactcaagatactccaatgaaaccttca
gctaaagcaggaattgaacaggaaatttataaagtgttcgagcaatatgcaaacagccat
aaaggtacaagctatgtgtatttaggaacagaagatgggggatatatacaatggccggaa
gagagtctaccagcaggatttgatccttcaaaaagaccttggtttaatgatgcaatgaat
aaaaagggaagtgttattagaacagctccatacagttataagtcccaactgcttacaagt
aatgctcgtacaattactgataaaaatgggaaaattataggtgccataggaatagacgta
cagcaaactaatattagcgatatgttaaataaaatgaaaattggtaaaacaggatattca
atgattgtacatagtaatggtcttataatggcagatggaaaaaatcctaaaaacaatttt
aaaaaggttggagaagttggtattaacggattagataagcttctagctaaagatctaaaa
tcatttgatgttgttgttgatggcgaaaagtatattgttaatccttataaagtagaagga
actgattggatactagcatcatttatgacagaaaaagagttaggagctggtgcaaaagaa
atagtaaatataatgatattttctgcaggggccatgttaatattggcaactattttattt
aattttctttccagtagtataacaaaacctatcttagcagtaacaaagagagtacaagat
tttgctaatttggatttttcagtagatgaaaaggcagacacactaaaatacttaaacagg
aaagatgaagcaggagatatgataagagcctttgtaagtatgagagagaatgtatcagaa
ttcattgtgaaaactgcacattcaacagaaaaggttgcagcttcatcggaagaattaact
gctacttcggagcaagcagctactgcatcaaatgaagtaagtaaggctattgaggaaatc
gcaaaaggagctactgatcaagctaaagatactcagatggcagcccataatgtagaagat
ttaggtaatttattagaacaagatttaaattatattgaagaattgaatgttgcggcagtt
gaaattgaaaggcaaaaatcagaaggttttttaattttgaaagaacttgttgaaaaaact
aagaaaaataatgattctgcaaacaatgtttaccatattatcatgagtaacaatgaaagt
gcagaaaaaattgaaaatgctagtactatgattcaaagtattgcagaccagacaaatctt
ttagctttaaatgctgcaatagaagcagcaagagctggagacgcaggtaaaggctttgca
gttgttgctgatgaaataagaaagcttgcagaacaatcaaataactttacaaatgacatt
aaaacagtaataactgggttaaagataaaatcacaaaatgcagttgatttgatgcagcaa
actaagcagataattgaggaacaagcttctagtgttggagaaactgaaggaaaatttgaa
gggatagcagaagcaatagattctataaaatctgtagttaataaacttaataattctgcc
aatttaatgacagaaaataaaaacaaaatcattgaattaactcaaaatttatctgcaatc
tctgaagagaatgctgctggaacagaacaagcatcatcatctatgcaagaacaagtcaat
acaattgaacaaattgccatagcaggagagagcttagctacaatctcagaagaattaaga
gtgttagtagacaaatttaaagtctag

DBGET integrated database retrieval system