KEGG   Hungateiclostridium clariflavum: Clocl_0868Help
Entry
Clocl_0868        CDS       T01661                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ccl  Hungateiclostridium clariflavum
Brite
KEGG Orthology (KO) [BR:ccl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Clocl_0868
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Clocl_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 AlaDh_PNT_C K_oxygenase Thioredoxin_4 Glutaredoxin FAD_binding_3 NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEV67554
UniProt: G8LVY7
LinkDB All DBs
Position
997758..999287
Genome map
AA seq 509 aa AA seqDB search
MLLDIEIKQQLEQYLALLENDIVIKVSAGSDKTSTDMVILIDEISKLSSKIHVEKAELER
TPSFSINRLNEDTGIVFAGVPLGHEFNSLVLALLQVGGRAPKVDDTYINQIKQLKGEYRF
ETYVSLSCHNCPDVVQALNIMSVLNPNIKHTMIDGAVFKEEVESKDIMAVPTIYLNGNFF
ESGRLTLEEILAKLGQESDDSYINEKEPFDVLVIGGGPAGVSSAIYAARKGLRTGILVER
FGGQILDTLGIENFISVPYTEGPKLAENLKEHVKRYNIDVINLQRAKSLRRKELLEVELE
KGAVLKSKTVIIATGARWRDVNVPGEKEFKTKGVAYCPHCDGPLFAGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFLPQLKADKVLQERLYRLPNVTVLTNVQTKEFTGKEKLEGITY
IQRDTNEEKHIEVQGVFIQIGLVPNTEWLGDSIERNAIGEIIVNHKNETSMPGVFAAGDC
TNSPYKQIIISMGSGATAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggatatagaaatcaaacagcaattagaacagtatttggcactccttgaaaac
gatatagtcattaaggttagtgctggaagtgataagacatccactgatatggttatactt
atagatgaaatttccaaactttcgtctaaaatacatgttgaaaaagcagagttggaaaga
actccaagctttagcattaaccgattgaatgaggatacaggtatcgtttttgctggtgtt
ccactaggtcatgaatttaattccttggtattggctctcctccaagtaggggggagagcc
cctaaggtagatgatacttatattaatcaaattaagcagctaaagggagagtatcgtttt
gaaacctacgttagcctaagctgccataattgtcccgatgtggtccaagcccttaatata
atgagtgttctcaatcccaatattaaacataccatgattgacggagctgtctttaaagaa
gaagttgaaagtaaggacataatggcagtacctacaatatacttaaatggcaatttcttt
gaaagcggccgattaacactggaggagattcttgctaaacttggacaggagtccgatgat
tcttatatcaatgaaaaagagccttttgatgttttagtcataggtggaggacctgccggc
gtgagttctgctatttacgctgcacgaaagggacttcgtaccggtattttggttgaaaga
tttggaggccagattttagatactttgggaattgagaattttatttcagttccatatacc
gagggacctaagctggccgagaatcttaaagagcatgtgaaaagatataatattgatgta
attaatcttcaaagagcaaaaagtttgaggcgtaaggaacttttggaagtggaattggaa
aaaggggctgtgcttaagagcaagaccgttattattgcaacaggagcgagatggcgtgat
gtaaacgttccgggagaaaaagagtttaaaaccaaaggagtggcctattgtcctcactgt
gacggaccattgtttgcagggaaagatgtagctgtaattggcggaggtaattccggtata
gaagctgctattgatttggcggggattgtaaagcatgttacagttctggaatttttgccc
caattaaaggccgataaggtgttacaggaacgtttatatagacttcccaacgtaactgta
cttacaaatgttcagacaaaagagtttaccggtaaagaaaagcttgaggggattacttat
atccagcgtgataccaatgaagaaaaacatattgaggttcaaggtgttttcattcagatt
ggtcttgtaccaaataccgaatggctcggagacagtattgaacgtaatgctatcggtgaa
attattgttaaccataaaaatgaaacctcaatgcctggagtatttgcagccggtgactgt
actaatagcccctataaacagattattatatccatgggttccggtgcaacggcagcactc
agtgcttttgattacttaattcgtaactaa

DBGET integrated database retrieval system