KEGG   Cronobacter condimenti: AFK62_09035Help
Entry
AFK62_09035       CDS       T04060                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK62_09035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccon02000]
    AFK62_09035
Enzymes [BR:ccon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFK62_09035
Transporters [BR:ccon02000]
 Other Transporters
  Pores ion channels [TC:1]
   AFK62_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALB62633
UniProt: K7ZX65
LinkDB All DBs
Position
complement(1965503..1966111)
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREAGIDFTLVAVDLAAKRTENGEDYLTINPKGQVPALLLDDG
TLLTEGVAIVQYIADKVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPGTPDE
YKTIAREQLQKKFEYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAYDNIAD
YQARVKARPEVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttttacaaagccggcgcgtgttcgctttcgccgcatatcattctgcgcgaa
gcgggtattgattttacgctggtggcagtcgatctggctgcgaaacgcacggagaacggc
gaagattatctgactatcaacccaaaaggtcaggtgccggcgctgctactggatgacggc
acactgctgaccgaaggtgtcgctatcgttcagtacatcgcagataaagtgccagaccgt
cagttgctcgcgccagtcggtagcatgacccgctaccatacgcttgagtggctgaactat
atcgcgactgaactgcacaaaggttttacgccgctctttcgtcctggtacgccggatgag
tacaaaaccattgcccgggaacagttacagaagaaattcgagtatgtgaacgaggcgctg
gcgcaaaaacagtggctgatggggctgcgtttcagcgtggcggatgcctatttatttacc
gtgctgaactgggcgaaagcggtggggctggaaatgcaggcttatgacaatatcgctgac
taccaggcccgtgtgaaagcgcgtcctgaagtggcggccgcgctgaaggcggaaggactg
agcgcctga

DBGET integrated database retrieval system