KEGG   Corvus cornix (hooded crow): 104692166Help
Entry
104692166         CDS       T03546                                 

Gene name
ZBTB16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ccw04121]
    104692166 (ZBTB16)
Ubiquitin system [BR:ccw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     104692166 (ZBTB16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2H2_jaz zf-C2H2_6 zf-met zf_UBZ zf-C2H2_2 zf-C2H2_11 zinc_ribbon_15 Endonuclease_7 zf-MYST zf-Di19 zf-C2H2_8 Zn-C2H2_12 Zn-ribbon_8 HNH_5
Motif
Other DBs
NCBI-GeneID: 104692166
NCBI-ProteinID: XP_019144023
LinkDB All DBs
Position
Unknown
AA seq 286 aa AA seqDB search
MPPGRSSVCTWGCQETCCFGSLSPHFRTNPSLFSPRKLHSGMKTYGCELCGKRFLDSLRL
RMHLLAHSAGAKALVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQTQSALQQ
HMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKGHKRI
HTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGA
SPYQCTICLEYCPSLSAMQKHMKGHKPEEIPTDWRIEKTYLYLCYV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgggcgtagctcggtgtgtacctggggctgccaggaaacgtgttgttttggg
tcactttccccccatttcaggactaacccttctttgttctcccctaggaagctgcacagt
gggatgaagacatacggatgcgagctgtgcgggaagcggttcctggacagcttgcggctg
cgaatgcacttactggctcactcagcgggtgccaaagccctggtctgcgatcagtgtggt
gcccagttctcgaaggaagatgccctggagacgcaccggcagacgcacactggtacagac
atggctgttttctgcctgctgtgcggcaagcggttccagacgcagagcgccctgcagcag
cacatggaggtgcacgctggggtgcgcagctacatctgcagcgagtgcaaccgcaccttc
cccagccacaccgcgctcaagaggcacctgcgctcccacacaggcgaccacccctacgag
tgcgagttctgcggcagctgcttccgggacgagagcacactgaagggccacaagcgcatc
cacaccggtgagaagccctatgagtgcaacggctgtggcaagaagttcagcctcaagcac
cagctggagacccactaccgggtccacacaggcgagaagccgtttgagtgcaagctgtgc
caccagcgctcccgggactactcggccatgatcaaacaccttcggacccacaatggcgct
tccccctaccagtgcaccatctgcctggagtactgccccagcctctccgccatgcagaag
cacatgaagggccacaaaccagaggagatccccaccgactggcggatagagaagacctat
ctctacctctgctatgtctaa

DBGET integrated database retrieval system