KEGG   Camelus dromedarius (Arabian camel): 105085712
Entry
105085712         CDS       T04642                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105085712 (AXIN2)
   04390 Hippo signaling pathway
    105085712 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105085712 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085712 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105085712 (AXIN2)
   05225 Hepatocellular carcinoma
    105085712 (AXIN2)
   05226 Gastric cancer
    105085712 (AXIN2)
   05217 Basal cell carcinoma
    105085712 (AXIN2)
   05213 Endometrial cancer
    105085712 (AXIN2)
   05224 Breast cancer
    105085712 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105085712 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    105085712 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105085712 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105085712 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105085712 (AXIN2)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    105085712 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 105085712
NCBI-ProteinID: XP_031324787
LinkDB
Position
16
AA seq 843 aa
MSSAVLVPRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
SLKDTKTSRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQA
VMEDNAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATANVRSTETVENTYRSFRRSDPVNPYHVSSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELETRHSLEERLQQIREDEEKEGSELALSSRDAGPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRARSPDHHHHHHQQYHPL
LPPGGKLPPAAASPASCPLLGAKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVR
CFCPGGAEYYSYSKCKSHPRLPEPSASEQFGGSRGSTPPKRSGKGTEPGPALPAREGGAP
GGAGALQLPGEEGGRSQDVWQWVLESERPGKPRPHSAQSTKRAYPLESARAAPAERAGRH
HLWGGSGGHPRTAPRAHPFAQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAASQ
QRDRNHSTTGQPGATSFSNPSLAAEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEVWDDEVVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagtagtgctgtgttggtgcctcgcctcccagaccccagcagcagcttccgggaggat
gctccgcggcccccggttccaggggaagaaggggagaccccaccgtgccagcccggagtg
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacaccaggcggaatgaggat
gggttgggggagccagaggggcgggcatctccggattcccctctgaccaggtggaccaaa
tcactgcactccttgttgggtgatcaggatggtgcttatcttttccggactttcttggag
agggagaaatgcgtggataccttagacttctggtttgcctgtaatgggttcaggcagatg
agcctgaaggataccaaaacttcacgagtagccaaagcgatctacaaaaggtacatcgag
aacaacagcattgtctccaagcagctgaaaccagccaccaagacctacataagagatggc
atcaagaagcagcagattgattcgatcatgttcgaccaagcacagactgagatccaggcg
gtgatggaggacaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggactggggagcttgaagctc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgctgacttcaag
tgcaaactgtcacccactgtggttggcttgtccagcaaaactctgagggctacagcaaat
gtgaggtccacagaaactgttgaaaacacatacaggtccttcaggaggagcgaccctgtg
aacccataccacgtaagttccggctatgtcttcgcgccggccaccagcgccaatgacagc
gagatatccagtgatgcactgaccgatgattccatgtccatgacggatagtagcgtagat
ggaatccctccttatcgtgtggggagtaagaaacagctccagagagaaatgcatcgcagc
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgaccccggtggaacccgccaccttcgcggccgagctgatctccaggctggagaag
ctgaagctggaattggagacccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggagggctcggagctggcgctgagctcccgggacgcggggcccacccag
caccccctctccctcctgccctcgggcagctatgaggaggacccgcagaccattctggat
gaccacctgtccagggtcctcaagacccccggctgccagtccccaggtgtgggccgctac
agcccccgcgcccgctcccctgaccaccaccaccaccaccaccagcagtaccacccgctc
ctcccgcccgggggcaagctgccccccgctgccgcctccccggccagctgccccctcctc
ggggccaagggcttcgtgaccaagcagacgacgaagcacgtccaccaccactacatccat
caccacgccgtccccaagaccaaggaggagatcgaggccgaggccacccagcgggtgcgc
tgcttctgccccgggggtgccgagtactactcctactcgaaatgcaagagccaccccagg
ttgccggagccctcagcatccgagcagttcggcggcagcagaggcagtaccccacccaaa
cgaagtgggaaaggcacggagccgggcccggccctgcccgccagggaaggaggggccccc
ggcggagcgggggcgctgcagcttcccggggaggaaggaggcaggtcgcaggatgtctgg
cagtgggtgctggagagcgagcggcccggcaagcccaggccccatagtgcccaaagcaca
aaacgggcctaccccttggagtctgcccgcgcagccccagcggagcgggccggccgccac
catctgtgggggggcagcggcgggcacccccgcacggcaccccgcgcccacccgttcgcc
caggaccctgccatgcctcccctgaccccacccaacaccctggcacagctggaggaggcc
tgccgcaggctggccgaggtgtccaagcccccaaaacagcggtgctgcgcagcaagtcag
cagagggacaggaaccactccaccactggtcagccaggagccacgtccttctccaaccca
agcctggctgcagaagatcacaaagagccaaagaaactagcaggggtccacgctctccag
gccagtgagctggtcgtcacttactttttctgcggagaagaaatcccctacaggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagccagcgatgagtttgcctgtggcgcggtgttcgaggag
gtctgggacgatgaggtggtgctccccatgtatgaaggcaggatcctggggaaggtggag
aggatcgactga

KEGG   Camelus dromedarius (Arabian camel): 105098424
Entry
105098424         CDS       T04642                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105098424 (AXIN1)
   04390 Hippo signaling pathway
    105098424 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105098424 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105098424 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105098424 (AXIN1)
   05225 Hepatocellular carcinoma
    105098424 (AXIN1)
   05226 Gastric cancer
    105098424 (AXIN1)
   05217 Basal cell carcinoma
    105098424 (AXIN1)
   05213 Endometrial cancer
    105098424 (AXIN1)
   05224 Breast cancer
    105098424 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105098424 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    105098424 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105098424 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105098424 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105098424 (AXIN1)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105098424 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 105098424
NCBI-ProteinID: XP_031303676
LinkDB
Position
Unknown
AA seq 867 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDQDADEDSGRDPAPPGRLAQKLLLETAAPRASSSRRYSEGREFRYGSWREP
INPYYVNSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEVRVEPHKFAAELIHRLEAIQRTREAEEKLEERLKRVRMEE
EGEDGDMSSGPPGASHKLPSAAAWHHFPPRYADVGCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHMPKMAGVLGAAGPGHGKHGPKLGAKLDSAGLHLHRHSHHHGH
HSAARPKEPAEAEASRRVQSSFAWGPELHGHVAKPRGHLENLGSAPNASDNLAYSGKVAT
TSKRNAKKAESGKNTNVEAPGPSEDAEKNQKIMQWIIEGEKEIIRHRKAGHGSSGAKKQQ
AHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRYVQEVIQRGRSCVRPVCTPVLSVVPAVSDLELSETETKSQRKAGGG
SMQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFDCGV
VFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccctttggacctcggagcaagtttcaccgaagatgcc
ccccgacccccagtgcccggtgaggagggtgaactggtgtccacagaccctaggcctgtc
agccacagcttctgctctgggaaaggtgctgggatcaaaggtgagacttcaacagccact
cccaggcgctcagatctggacctggggtacgagcccgagggcagcgcgtcccctaccccg
ccatacttgaagtgggccgagtcgctgcactccttgctagacgatcaagacgggataaac
ctgtttaggactttcctgaagcaggaggactgcgccgatctgctggacttctggtttgcc
tgcagcggcttcaggaagctggagccctgtgactcgaatgaggaaaagaggcttaagctg
gccaaagccatctaccgaaagtacatccttgacaacaatggcattgtgtccaggcaaacc
aagccagccaccaagagcttcataaaggactgcatcatgaagcagcagatcgatcctgcc
atgtttgaccaggcccagacggaaatccagtccaccatggaggagaatacctacccctca
ttcctcaagtctgatatttatttggaatacacgaggacaggctcggagagcccaaagctc
tgtagtgaccagagctctgggtcaggtaccgggaagggtgtccccggatacctgcccact
ttgaatgaagacgaggaatggaagtgtgaccaggatgcagacgaagacagtggcagagac
cctgctcctcctggcaggctcgcacagaagctgctcctggagacagccgccccgagggcc
tcttcaagtagacggtacagcgaaggcagagaattcaggtatggatcctggcgggagccc
atcaacccctactacgtcaactctggctatgcactcgccccagccaccagcgccaacgac
agtgagcagcagagcctgtccagcgatgctgatagcctgtccctcaccgacagcagcgtg
gatggaatcccaccatacaggatccgcaagcagcaccgccgggagatgcaggagagcgtc
caggtcaacgggcgggtgcctctacctcacattcctcgcacttaccgaatgccaaaggaa
gtccgtgtggagccccacaagttcgccgcggagctcatccaccgcctagaggccatccag
cggacgcgggaggccgaggagaagctggaggagcggctaaagcgtgtgcggatggaggag
gaaggcgaggatggcgacatgtcctctggtcccccaggggccagtcataagttgccttct
gcagcagcctggcaccacttcccgccccgctacgcggacgtgggctgcgtggggctgcgg
gacgcacacgaggagaaccccgagagcatcctggatgagcatgtgcagcgagtcatgagg
acgcccggctgccagtcaccagggcccggccaccgctccccagacagtgcacatatgccc
aagatggcgggggtgctgggggccgcagggcccgggcatgggaagcacgggcccaagttg
ggggcaaagctggactcagctggcctgcacctccacagacacagccaccaccatggccac
cacagtgcagccaggcccaaggagccagccgaggctgaggcctcccgccgggtccagagc
agcttcgcgtggggtccagagctacacggccacgtggccaagccccgcggccatctggag
aacttgggctccgcgcccaacgccagcgacaatctggcctacagtggaaaggtggccaca
acctctaaaagaaatgctaagaaggccgagtcagggaagaacaccaacgtggaggcacca
ggcccctcagaagatgcggagaagaaccagaagatcatgcagtggatcatcgagggcgag
aaggagatcatccggcaccggaaggccggccatgggtcatccggggcaaagaagcagcag
gcccatgagagctccaggcccctgtccatcgagcgtcccggggccgtgcatccctgggtc
agcgctcagctccggaactcggtccagccctcccatctcttcattcaagaccccacgatg
ccacccaacccggccccgaaccctctgacgcagctggaggaggcccgcaggcgtctggag
gaggaagagaaaagagccagcaagttgccctcaaaacagaggtatgtgcaggaggtcatc
cagcgggggcgctcctgcgtcaggccagtgtgcacgcccgtgctgagcgtggtgccagcg
gtgtcggacctggagctctccgagacagagacgaaatcacagaggaaggcgggtggtggg
agcatgcagccgtgcgacagtatcgtcgtggcctactacttctgtggggagcccatcccc
taccggaccctggtgaggggccgtgcggttaccctgggccagttcaaggagctgctgaca
aagaaaggcaactacagatactacttcaagaaagtgagtgacgaatttgactgtggtgtg
gtgtttgaggaagtgcgggaagacgaggccgtcctgcccgtcttcgaggagaagatcatc
ggaaaggtggagaaggtggactga

DBGET integrated database retrieval system