KEGG   Camelus dromedarius (Arabian camel): 105085813
Entry
105085813         CDS       T04642                                 

Gene name
FABP3
Definition
(RefSeq) fatty acid-binding protein, heart
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105085813 (FABP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105085813 (FABP3)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105085813 (FABP3)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 ProQ_C
Other DBs
NCBI-GeneID: 105085813
NCBI-ProteinID: XP_010974402
LinkDB
Position
13
AA seq 133 aa
MVDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVGNMTKPTTIIEVNGDTITVKTQSTFKN
TAISFKLGVEFDETTADDRKVKSTVTLDGGKLVHLQKWNGQESTLVRELVDGKLILTLTH
GSVVSTRTYEKEA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtggacgcgttcgtgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactaggtgtgggttttgctaccaggcaggtgggcaacatgactaagcctacc
acaatcatcgaagtgaatggggacacaatcaccgtaaaaacgcaaagcaccttcaagaac
acggcgatcagcttcaagctgggagtggagttcgatgagacaacagcagatgacaggaag
gtcaagtccactgtgacgctggatggaggcaaacttgtccacctgcagaagtggaatgga
caagagtcaacacttgtgcgggaactcgttgatgggaaactcatcctgacgctcacccac
ggcagtgtagttagcactcgcacttatgagaaagaggcatga

DBGET integrated database retrieval system