KEGG   Camelus dromedarius (Arabian camel): 105087202
Entry
105087202         CDS       T04642                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04068  FoxO signaling pathway
cdk04144  Endocytosis
cdk04218  Cellular senescence
cdk04350  TGF-beta signaling pathway
cdk04380  Osteoclast differentiation
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04659  Th17 cell differentiation
cdk04926  Relaxin signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05142  Chagas disease
cdk05161  Hepatitis B
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05220  Chronic myeloid leukemia
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105087202 (TGFBR2)
   04350 TGF-beta signaling pathway
    105087202 (TGFBR2)
   04390 Hippo signaling pathway
    105087202 (TGFBR2)
   04068 FoxO signaling pathway
    105087202 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105087202 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105087202 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    105087202 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105087202 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    105087202 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    105087202 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105087202 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105087202 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    105087202 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105087202 (TGFBR2)
   05212 Pancreatic cancer
    105087202 (TGFBR2)
   05225 Hepatocellular carcinoma
    105087202 (TGFBR2)
   05226 Gastric cancer
    105087202 (TGFBR2)
   05220 Chronic myeloid leukemia
    105087202 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105087202 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105087202 (TGFBR2)
   05161 Hepatitis B
    105087202 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    105087202 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105087202 (TGFBR2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     105087202 (TGFBR2)
Protein kinases [BR:cdk01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   105087202 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 105087202
NCBI-ProteinID: XP_031325678
LinkDB
Position
17
AA seq 532 aa
MLVTDNNGAVKLPQLCKFCDVRASTCDNQKSCLSNCSITAICEKPHEVCVAVWRKNDENI
TLETVCHDPKIAYHGFVLDDAASPKCIMKEKKGSGETFFMCSCSSDECNDHIIFSEEYAT
NNPDLLLVIFQVTGVSLLPPLGIAIAVIVTFYCYRVHRQQKLSSSWDSGKPRKLMEFSEH
LAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVVSWEDLRKLGGSLARGIAHLHSDRTLCGRPKMPIVHRDLKSSNILVKGDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRERPEIPSSWLSHQGIQTVCE
TLAECWDHDPEARLTAQCVAERFSELEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgctggtcacggacaataacggcgccgtcaagcttccgcaactgtgtaagttctgcgac
gtgcgcgcctccacctgtgacaaccagaaatcctgcctgagcaactgcagcatcacggct
atctgcgagaagccgcacgaagtctgcgtggccgtctggagaaagaatgatgagaacatc
acactagagacggtttgccacgaccccaagatcgcttaccatggctttgttctcgacgac
gcggcttctcccaagtgcatcatgaaggaaaagaaggggtcaggagagactttcttcatg
tgttcctgtagctccgatgagtgcaacgaccacatcatcttctctgaagagtacgccacc
aacaacccagacttgctgctagtcatattccaggtgacaggcgtcagcctcctgccgccg
ctgggcatcgccatcgccgtcattgtcaccttctactgctaccgtgttcaccggcagcag
aagctgagctcgtcctgggactcggggaagccgcggaagctgatggagttcagcgagcac
ctggccatcatcctggaagacgaccgctccgacatcagctccacctgcgccaacaacatc
aaccacaacacggagctgctgcccatcgagctggacaccctggtgggcaagggccgcttc
gccgaggtctacaaggccaagctgcggcagaacacgtctgagcagttcgagaccgtggcc
gtcaagatcttcccctacgaggagtatgcctcctggaagacggagaaggacatcttctcg
gacatcaacctcaagcacgagaacatcctccagttcctgacggccgaggagcgcaagacg
gagctgggcaagcagtactggctgatcaccgccttccacgccaagggcaacctgcaggag
tacctcacccggcacgtcgtcagctgggaggacctgcgcaagctgggcggctcgctggcc
cgcggcatcgcgcacctgcacagcgaccgcaccctgtgcggccggcccaagatgcccatc
gtgcacagggacctcaagagctccaacatcctggtcaagggcgacctcacctgctgcctc
tgcgacttcgggctctccctgcgtctggacccgactctgtctgtggacgacctggccaac
agtgggcaggtgggaactgcacgatacatggccccagaagtcctcgagtccaggatgaat
ttggagaatgttgagtccttcaagcagacagatgtctactccatggccctggtgctctgg
gagatgacgtcccgctgcaacgcggtgggagaagtgaaagattacgagcctccgttcggt
tccaaggtgcgggagcacccctgtgtggaaagcatgaaggacaacgtgctgagagaccgg
gaacggccggagatccccagctcctggctcagccaccagggcatccagacggtgtgtgag
acgctggccgagtgctgggaccacgaccccgaggcccggctcaccgcgcagtgcgtggcc
gagcgcttcagcgagctggagcatctggacagactctcggggaggagcagctcggaggag
aagattcccgaagatggctccctgaacactaccaaatag

DBGET integrated database retrieval system