KEGG   Camelus dromedarius (Arabian camel): 105087358
Entry
105087358         CDS       T04642                                 

Gene name
ABCB1
Definition
(RefSeq) ATP-dependent translocase ABCB1 isoform X1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk02010  ABC transporters
cdk04976  Bile secretion
cdk05206  MicroRNAs in cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    105087358 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    105087358 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    105087358 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    105087358 (ABCB1)
Enzymes [BR:cdk01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     105087358 (ABCB1)
Transporters [BR:cdk02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    105087358 (ABCB1)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105087358 (ABCB1)
CD molecules [BR:cdk04090]
 Proteins
  105087358 (ABCB1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 Rad17 RsgA_GTPase Zeta_toxin G-alpha AAA AAA_5 AAA_29 AAA_14 AAA_7 APS_kinase AAA_15 DUF815 SbcCD_C PRK AAA_30 AAA_24 AbiH DUF2207 NTPase_1
Other DBs
NCBI-GeneID: 105087358
NCBI-ProteinID: XP_031310691
LinkDB
Position
7
AA seq 1281 aa
MDLEEEHNVRARKKNFLKRDKKSKKDEKKEKKPTVSTFAMFRYSNWLDRLYMVLGTTAAI
IHGAALPLMMLVFGDMTDSFANVGNFGNMTASNVTNESYMNSTNFGSTLEKDMTTYAYYY
SGIGAGVLIAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDD
VSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSS
FTDKELLAYAKAGAVAEEVLAAVRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANIS
IGVAFLLIYASYALAFWYGTSLVLANEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANA
RGAAYEIFKIIDNKPSIDSYSNNGHKPDNIKGNLEFRNVHFSYPSRREVKILKGLSLQVQ
SGQTVALVGNSGCGKSTTVQLMQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPV
LFATTIAENIRYGRENVTMDEIKKAVKEANAYDFIMKLPNKFDTLVGERGAQLSGGQKQR
IAIARALVRNPRILLLDEATSALDTESEAVVQVALDKAREGRTTIVIAHRLSTVRNADVI
AGFDDGVIVEQGNHYQLMKEKGIYFKLVTMQTRGNEIELENSADGSKSEMDALDTSPKDL
GSCLIRRKSTRKSIHGPQGQDRKLSTEEALDDSVPPVSFWRILKLNVTEWPYFVVGIFCA
IINGGLQPAFSVIFSRIIGVFARDDDPQTKQHNSNMFSLLFLILGIISFITFFLQGYTFG
KAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQ
NVANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVIEMKMLSGQALKDKKELEGAGKIAT
EAIENFRTVVSLTREEKFEYMYAQNLQVPYRNSLRKAHIFGITFSLTQAMMYFSYAGCFR
FGAYLVAHGLMDFQDVLLVFSAIVFGAMAVGQVSSFAPDYAKAKISASHIIMIIEKVPLI
DSYSTEGLKPITMEGNVTFNEVKFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKST
VVQLLERFYDPLAGKVLIDGQEIKHLNVQWLRAHMGIVSQEPILFDCSIGENIAYGDNSR
VVSQEEIVRAAKEANIHPFIEGLPNKYNTRVGDKGTQLSGGQKQRIAIARALVRQPNVLL
LDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADVIVVIQNGRVMEHGTHQ
QLLAQKGIYHSMVSVQAGAKR
NT seq 3846 nt   +upstreamnt  +downstreamnt
atggatcttgaagaagagcacaatgtaagggcaaggaagaagaactttttgaaaagagac
aaaaaaagtaaaaaagatgaaaagaaagaaaagaaaccaactgtcagtacttttgcaatg
tttcgctattcgaattggctggatagattgtacatggtgctggggacgacggccgccatc
atccacggagctgcactccccctcatgatgctggtttttggagacatgacggatagcttt
gcaaatgtaggaaattttggaaacatgactgcttcaaacgtaactaatgaaagttatatg
aacagtacaaattttggcagcactctggagaaggatatgaccacgtacgcctactattac
agcggaatcggtgctggggtgctcattgctgcttacatccaggtttcattctggtgcctg
gcagctggaagacaaatacacaaaattcgaaaacagttttttcatgctatcatgcgacag
gagatcggctggtttgatgtgcatgatgttggagagcttaacacccgactcacagatgat
gtctccaaaattaatgaaggcattggtgacaaaattggaatgttctttcagtcaatggca
acgttcttcactggttttatagtaggatttacccgtggttggaagttaacccttgtgatt
ttggccatcagtcctgttcttggtctatcagcagctgtctgggcaaagatattgtcttca
tttactgataaagaactcttggcatacgcaaaagctggagcagtagctgaagaggtctta
gcggcagttagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtacaac
aaaaatttagaagaagctaaaagaattggaataaagaaagctattacagccaacatttct
ataggtgttgccttcctgctgatctatgcatcctatgctctggcattctggtatgggacc
tccttggtcctcgcaaatgaatattctattggacaagtactcactgtcttcttttctgta
ttaattggggcttttagtgttggacaggcatctcccagcattgaagcatttgcaaacgca
agaggcgcggcttacgaaatcttcaagataattgataacaaaccaagcattgacagctat
tcgaataatgggcacaaaccagacaacattaagggaaatttagaattcagaaatgtacac
ttcagttacccatctcgacgtgaagttaagatcttgaagggcctcagcttgcaggttcag
agcgggcagacggtggccctggttgggaacagcggctgtggaaaaagcaccacggtccag
ctgatgcagaggctctatgaccccacggagggcgtggtcagtattgatggacaggacatt
aggaccatcaatgtaaggtatctgcgggaaattattggtgtggtgagtcaggaacctgta
ttgtttgccacgacgatagctgagaacattcgctatggccgtgaaaatgtcaccatggat
gagattaagaaagccgtcaaggaagccaacgcctatgactttatcatgaaactgcctaat
aaatttgacaccctggttggagagagaggggcccagctgagcggtggacagaaacagaga
atcgccatcgctcgggccctggttcgcaaccccaggatcctcctgctggatgaggccaca
tcggcactggacactgagagtgaagcggtggttcaggtggctctggataaggccagagaa
ggtcggaccaccattgtgatagcacatcgtttgtccacagtccggaatgctgacgtcatc
gctggttttgatgatggagtcattgtggagcaaggaaatcactaccagctaatgaaggag
aagggcatttacttcaaactcgtcacaatgcagacaagaggaaatgaaattgaattagaa
aattcagctgatggatccaaaagtgaaatggatgccctggacacatctccaaaagattta
ggatcctgtctaataagaagaaaatcaactcgcaagagtatccatggaccacaaggccaa
gacagaaagctcagtacagaagaggccttggatgacagtgtacctccagtttccttttgg
aggattctgaagctaaatgtaactgaatggccttattttgtggttggtatattttgtgcc
attataaatggaggcctgcaaccagcattttcagtaatattttcaaggattataggggtt
tttgccagagacgacgatcctcagacaaaacaacacaacagtaacatgttttcgctattg
tttcttatccttggaattatctcttttattacatttttccttcagggctacacgtttggc
aaagccggagagatccttaccaagcggctccgatacatggttttcaggtccatgttgaga
caggatgtgagctggttcgatgaccctaaaaacaccacgggagcattgacgaccaggctt
gcgaatgacgccgctcaagttaaaggggctataggttccagacttgctgtaattacccag
aatgtcgcaaatcttgggacaggcattattatatccttaatctatggctggcagttaaca
cttttactcttagcaattgtgcccatcattgcaatagcaggagttattgaaatgaaaatg
ctatctggacaagcactgaaagataaaaaagaactagaaggtgccgggaagattgcaacg
gaagcaatagaaaacttccgaacagttgtttccttgactcgagaggagaagtttgaatat
atgtatgcccagaatctgcaggtaccatacagaaactctctgaggaaggcgcacatcttt
ggaatcacgttctccctcacccaggcaatgatgtatttctcttacgctggctgtttccgg
tttggcgcctacttggtggcgcatggcctcatggactttcaggatgttctgttagtgttc
tcagctatcgtctttggagccatggctgtagggcaggtcagttcatttgctcctgactat
gccaaggccaaaatttcagcatcccacatcatcatgatcattgaaaaagtccctctgatc
gacagctatagcacggaaggcctgaagccgattacaatggaaggaaatgtgacatttaat
gaagtcaagttcaactatcccacgcgaccagacatccctgtgcttcagggactgagcctc
gaggtgaagaaaggccagaccctggccttggtgggcagcagcggctgtgggaagagcacg
gtggtccagctcctggagcggttctacgaccccttggctgggaaagtgctaattgacggc
caggaaataaagcatctgaatgtccagtggctccgggcacacatgggcatcgtgtcccag
gagcccatcctgttcgactgcagcatcggcgagaacattgcctacggagacaacagccgg
gtcgtgtcgcaggaggagatcgtgcgggcagccaaggaggccaacatacaccccttcatc
gaggggctgcctaataaatataacaccagagtaggagacaaaggaactcagctctctggt
ggccagaaacagcgcattgcaatagctcgtgcccttgttagacagcctaatgttttgctt
ttggatgaagctacatcagctctggatacagaaagtgaaaaggttgtccaagaagccctg
gacaaagccagggaaggccgcacctgcatcgtgattgctcaccgcctgtccaccatccag
aacgcagatgtgatcgtggtgattcagaacggcagagtcatggagcatggcacgcatcag
cagctgctggcgcagaaaggcatctatcattccatggtcagtgtccaggccggagcaaag
cgctag

DBGET integrated database retrieval system