KEGG   Camelus dromedarius (Arabian camel): 105087377
Entry
105087377         CDS       T04642                                 

Gene name
FZD1
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-1
  KO
K02432  frizzled 1/7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105087377 (FZD1)
   04390 Hippo signaling pathway
    105087377 (FZD1)
   04150 mTOR signaling pathway
    105087377 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105087377 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105087377 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105087377 (FZD1)
   05205 Proteoglycans in cancer
    105087377 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105087377 (FZD1)
   05226 Gastric cancer
    105087377 (FZD1)
   05217 Basal cell carcinoma
    105087377 (FZD1)
   05224 Breast cancer
    105087377 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105087377 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    105087377 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105087377 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105087377 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105087377 (FZD1)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105087377 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 105087377
NCBI-ProteinID: XP_010976329
LinkDB
Position
7
AA seq 647 aa
MAEEEAPKKSRASGGGASWELCARALAAGPVAEGSGDTGSRRRRPSAHSRHLARRLLLLL
WLLEAPLLLGVRAQAAGQGPGPGQQPPPPPPQQQQSGQQYNGERGISIPDHGYCQPISIP
LCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQ
ALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSL
LPEFWTSNPQHGGGGHRGGGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggcctcgggcggcggcgcgagctgggaa
ctttgtgccagggctctcgcggctgggccggtggcagagggaagcggggacacgggcagc
cgccgccgccgtccctcagctcactcccggcacttagcgcgccggctgctactactgctt
tggctgctggaggctccgctgctgctgggggtccgggcgcaggcggctggtcaggggccc
gggccgggacagcagcccccgcctccgccacctcagcagcagcagagcgggcagcagtac
aacggcgagcggggcatctctataccggaccacggctactgccagcccatttccatcccg
ctgtgcacggacatcgcatacaaccagactatcatgcctaacctgctgggccacacgaac
caggaggatgcgggcctcgaggtgcaccagttctatccgctagtgaaggtgcagtgctcg
gccgagctcaagttcttcttgtgctccatgtacgcgcccgtgtgcactgtgctggagcag
gctctgccgccttgccgctccctgtgcgagcgcgcgcgccagggctgtgaggcgctcatg
aacaagttcggcttccagtggcctgacacactgaagtgcgagaagttcccggtgcacggc
gccggcgagctgtgcgtgggccagaacacttcggacaagggcaccccgacgccctcattg
ctgcctgagttctggaccagcaatccccagcatggcggcgggggtcaccgcggcggcggc
ggcttcccgggcggcgccggcgcgtcagagcgaggcaagttctcgtgcccgcgcgccctc
aaggtgccgtcttacctcaactaccactttctgggggagaaagactgcggcgcgccctgc
gagccgaccaaggtgtacgggctcatgtactttgggccggaagagctgcgcttctcgcgc
acctggatcggcatctggtcggtgctgtgctgcgcctccacgctcttcacggtgctcacg
tacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcctgtcaggc
tgctacacggcagtggccgtggcctacatcgccggcttcctgctggaggaccgggtggta
tgtaatgacaagttcgccgaggacggggcgcgcacagtggcgcagggcaccaagaaggag
ggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgg
gtgatcctgtcgctcacctggttcctggcagctggcatgaagtggggccacgaagccatc
gaggctaactctcagtattttcacctggctgcctgggccgtgccggccatcaagaccatc
accatcctggcgctgggccaggtggacggcgacgtgctgagcggggtgtgcttcgtgggg
ctcaacaacgtggacgcgctgcgcggcttcgtgctggcgccactgttcgtgtacctgttc
atcggtacatctttccttctggcaggcttcgtgtccctcttccgcattcgcaccatcatg
aagcacgacggcaccaagaccgagaagctggagaagctcatggtgcgcatcggcgtcttc
agcgtgctttacacggtgccagcgactatcgtcatcgcctgctacttctatgagcaggcc
ttccgggaccagtgggagcgcagctgggtggcccagagctgcaagagctatgccatcccc
tgcccccacctccaggcgggcggaggcgcccctccgcacccgcccatgagccccgacttc
acagtcttcatgatcaagtaccttatgacgctgatcgtgggcatcacgtcaggcttctgg
atctggtccggcaagaccctcaactcctggaggaagttctacaccaggctaaccaacagc
aaacagggggagaccaccgtctaa

KEGG   Camelus dromedarius (Arabian camel): 105089729
Entry
105089729         CDS       T04642                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105089729 (FZD9)
   04390 Hippo signaling pathway
    105089729 (FZD9)
   04150 mTOR signaling pathway
    105089729 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105089729 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105089729 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089729 (FZD9)
   05205 Proteoglycans in cancer
    105089729 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105089729 (FZD9)
   05226 Gastric cancer
    105089729 (FZD9)
   05217 Basal cell carcinoma
    105089729 (FZD9)
   05224 Breast cancer
    105089729 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105089729 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    105089729 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105089729 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105089729 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105089729 (FZD9)
   04090 CD molecules [BR:cdk04090]
    105089729 (FZD9)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105089729 (FZD9)
CD molecules [BR:cdk04090]
 Proteins
  105089729 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 105089729
NCBI-ProteinID: XP_031288583
LinkDB
Position
18
AA seq 591 aa
MAVLPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQMMEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATVGPAEPHKGLGMLPVAPRPA
RPPGDAAPGLGGGGTCENPEKFQYVEKSRSCAPRCGSGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCLAATTPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRASGGYGRGTHCQYKAPTVVLHMTKTDPTLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtgctgccgctccgccgggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggaaatcggccgtttcgacccggagcgcgggcgcgggccggcgccttgccag
atgatggagatccccatgtgccgtggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtctcagggcgaggcagccgccgagctggccgagttcgcgccgctcgtg
cagtacggctgccacagccacctgcgcttcttcctatgctcgctctacgcgcccatgtgc
acggaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcgcggctg
cgctgcgcgcccatcatggaacagttcaacttcggctggccggactcgctggactgcgcc
cggctgcccacgcgcaacgacccacacgcgctctgcatggaggcgcccgagaatgccacg
gtgggccctgcggagccccacaagggcctgggcatgttgcccgtggcgccgcggcccgcg
cggccccccggcgacgccgccccgggcttgggcggtggcggcacctgcgagaacccggag
aagttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcgggtcgggcgtcgag
gtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtcggcg
ctgtgcttcttctccactgccttcaccgtgctcaccttcctgctggagcctcaccgcttc
cagtaccccgagcgccccatcattttcctctccatgtgctacaacgtctactcgctagcg
ttcctcatccgcgcggtggctggggcccagagcgtggcctgcgaccaggaggcgggtgcg
ctgtacgtgatacaggagggactggagaatacgggctgcaccctcgtcttcctgctgctc
tactacttcggcatggccagctcgctgtggtgggtggtgctgaccctcacctggttcctg
gccgccggcaagaaatggggccatgaggccatcgaggcccatggcagctacttccacatg
gcggcctggggcttgccagccctcaagaccatcgttatcctgacactgcgcaaggtggcg
ggggatgagctgaccgggctttgctacgtggccagcatggatgcggctgcgcttaccggc
tttgtgctggtgcccctctcctgctacctggtgctgggcaccagtttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacaggtggcaccaacacggagaag
ctggagaagctcatggtcaagattggagtcttctccattctctacacggttcccgccacc
tgcgtcattgtgtgctacgtctatgaacgcctcaacatggacttctggcgcctgagggcc
acagagcagccgtgcttggcagccaccacgcccggtggccggagggactgctcactgcaa
gggggctccgtgcccacggtggctgtctttatgctcaaaatcttcatgtcgctggtggtg
ggcatcaccagcggcgtctgggtatggagctccaagactttccagacttggcagagcctg
tgccaccgcaagatggcagctggccgggcccgggcaaaggcctgccgggcctcagggggc
tatggccgtggcactcactgccagtataaggcccccaccgtcgtcttgcacatgactaag
acggaccctactctggagaaccccacacacctctag

KEGG   Camelus dromedarius (Arabian camel): 105090522
Entry
105090522         CDS       T04642                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105090522 (FZD6)
   04390 Hippo signaling pathway
    105090522 (FZD6)
   04150 mTOR signaling pathway
    105090522 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105090522 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105090522 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090522 (FZD6)
   05205 Proteoglycans in cancer
    105090522 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105090522 (FZD6)
   05226 Gastric cancer
    105090522 (FZD6)
   05217 Basal cell carcinoma
    105090522 (FZD6)
   05224 Breast cancer
    105090522 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105090522 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    105090522 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090522 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105090522 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105090522 (FZD6)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105090522 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha
Other DBs
NCBI-GeneID: 105090522
NCBI-ProteinID: XP_031295291
LinkDB
Position
25
AA seq 712 aa
MEMFTFLWTCIFLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQRTAALEMEL
FLPLANLECSPNVETFLCKAFVPTCTDQIDVVPPCRKFCEKVYSDCKKLMDTFEIQWPEE
LECDRLQYCDETVPEIFDPHTEFLDPQKETEQVQRDIGFWCPRHLKTSGGQGYKFLGIEQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLELGNTVVLGSQNKACTILFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTIMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKKDPISESRRVLQESCEFFLKHNSKVKHK
KKHHKPSSHKLKVISKSMGTSTGATANHGTSAVAITNHDYLGQETLTEIQTSPETSVREV
RADGASTPKLREQDREEPASPAASSSRPCGEQTDRKGRAGNVSDQSSVSGSARSEGRLTP
KSDVLETGPVQSNSLQVPSPSEPGSLKGSMSLLVHSASGVRKEQGTGRHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtttacatttttgtggacatgtatttttctacccctcgtaagagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgatcagagaactgctgctttggaaatggagctt
tttcttcctcttgcaaatctggaatgttccccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgcacagaccaaattgatgtggttccaccctgtcgtaaattctgtgag
aaagtatattctgattgcaaaaaattaatggatacttttgagatccaatggcctgaggaa
cttgaatgtgacagattacaatactgtgatgagactgttcctgagatttttgatccacac
acagagtttcttgatcctcagaaggaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagttcctgggaattgagcag
tgtgcacctccatgccccaacatgtattttaaaagtgatgagctagagtttgcaaaaagc
tttattggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgtgagaagattcagatacccagagagaccaattatatattactccgtctgt
tacagcattgtatctcttatgtacttcataggattcctcctaggcaacagcacagcctgc
aataaggcagatgagaagctagaacttggtaacacagttgttctaggctctcaaaataag
gcttgcaccattttgtttatgtttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgctgggagaaaatggagttgtgaagccatt
gagcaaaaagcagtgtggtttcacgctgttgcgtggggaataccaggttttctgaccatt
atgcttcttgccatgaacaaagttgaaggggacaatatcagtggagtgtgctttgtcggc
ctttatgacctggatgcttctcgctactttgtgctcttgccactgtgtctttgtgtgttt
gtcgggctgtctcttcttttagctggcattatttctttaaatcatgttcgacaagttata
cagcatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttt
agtggcctgtatcttgtgccattggtgacgcttcttggatgttacgtctatgagcaagtg
aacaggattacctgggagataacgtgggtctctgaccattgtcgtcagtaccatatccca
tgtccctatcaggcaaaaacagaaactcgaccagaattggctttgtttatgataaaatac
ctgatgacattaattgttggcatctctgccgtcttctgggttggaagcaaaaagacgtgc
acagagtgggctgggttttttaaacgaaatcgcaagaaagatccaatcagtgaaagtcga
agagtactacaggagtcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcaccacaaaccaagttcacataagctgaaggtcatttccaaatccatgggaacc
agcacgggagctacagccaatcacggcacttctgcagtagcaatcactaaccatgactac
ttaggacaagaaactttgacagaaatacaaacctcaccagaaacgtcagtgagagaggtg
agagcagacggagccagcacccccaaattaagggaacaggaccgtgaggaacctgcctcc
cctgcagcatccagctccagaccatgtggggagcagaccgacaggaagggccgggcaggc
aatgtgagcgatcagagcagtgtgtctggaagcgcgcggagtgagggaaggctaactccg
aagagtgatgtcttggaaactggcccggtacagagcaacagcttgcaggtccccagccct
tcagagccgggcagcctcaaaggctccatgtcactgcttgttcactcagcttcaggagtt
agaaaagagcagggcactggccgtcactcagatacctga

KEGG   Camelus dromedarius (Arabian camel): 105092660
Entry
105092660         CDS       T04642                                 

Gene name
FZD10
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-10
  KO
K02842  frizzled 9/10
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105092660 (FZD10)
   04390 Hippo signaling pathway
    105092660 (FZD10)
   04150 mTOR signaling pathway
    105092660 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105092660 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105092660 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092660 (FZD10)
   05205 Proteoglycans in cancer
    105092660 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105092660 (FZD10)
   05226 Gastric cancer
    105092660 (FZD10)
   05217 Basal cell carcinoma
    105092660 (FZD10)
   05224 Breast cancer
    105092660 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105092660 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    105092660 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105092660 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105092660 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105092660 (FZD10)
   04090 CD molecules [BR:cdk04090]
    105092660 (FZD10)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105092660 (FZD10)
CD molecules [BR:cdk04090]
 Proteins
  105092660 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 105092660
NCBI-ProteinID: XP_031298337
LinkDB
Position
32
AA seq 896 aa
MRAGLQAKGPLYGQGHKTQIPPRFESALRPGPTIKAGEMRPRPLRRTSPPPPSASLRTPG
NPGALGGPGTIPGDPRDRGRRRGGSEEAKLEAGGEGEGAAGGTDAGGRRDGAGAGAGRAA
GARLSLCKAAAGRGARPGGRGLSALCFFPLCLFASGQLGTRPRNSCGPGGRGRGRRGEGG
AAASRRRRAARRPARPRRRRAALPSRAPRAPHERPKFCAAVSCSRRRARARVRAPLAPGI
VRKLCSSPPRLPHLGGGRARRAGPGRRSAHRWSRAGRARGGARAGTRSRGQQPEPGSGGA
EGSGPPREGASDASMQRPGPAXWLVLQXVMGSCAAISSMDMSXSGDGKCQPIEIPMCKDI
GYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPA
CRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMF
PPLFRPQRPHSAQEHQLKDGAPGRAGCDNPGKFHHVEKSAACAPLCTPGVDVYWSRDDKH
FAVVWLAVWSVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGA
ESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHE
AIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACY
LIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYE
RLNVEYWKVLATQHECKMNNQTKNLDCLMAASIPAVEIFMVKVFMLLVVGITSGMWIWTS
KTLQSWQSVCSRRFKKKSRRKPASVITNSGIYKKAQHPPKTRLGKYEIPAQPPTCV
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgcgggcaggtttacaagctaaggggccactttatggccaaggccataaaacgcaaatc
ccacctcgctttgaaagcgccctccgcccgggacccaccataaaagcaggggagatgcgc
ccccggcccctgcggcggaccagcccgccccctccttcggccagtctccgaactcccggt
aaccccggcgcccttggggggccggggacgatcccaggggaccccagggacagggggcgg
aggcggggaggcagcgaggaggccaagttggaggccggcggagagggcgaaggagcggcg
ggagggacggacgcgggagggcggcgggacggggcgggggcgggggcggggcgggccgcg
ggggctcggctttctctatgcaaagcggcggcggggcggggcgcgcggcccggggggcgg
ggcctgtcagcgctctgctttttccccctttgccttttcgcgagcggtcagctcgggacc
agacctcggaacagctgcgggccggggggccggggccggggccggcgcggagagggcgga
gccgccgcgagccgccgcaggcgcgccgcgcgccggcccgcccggccgcgccgccgccgc
gccgccctccccagccgcgcgccgcgcgctccccacgagaggccaaagttttgcgcggca
gtgagttgcagccggcggcgggcccgcgcgagagtccgggcccctctcgctcccggtatt
gttcgcaaactttgctcctctcctccgcggctcccccacctcggcggaggccgcgcgcgg
agagcagggccggggaggcgctctgcgcaccgctggagccgggctgggcgggcgaggggg
ggggcccgagcagggacgaggagccggggccagcagcccgagcccggcagcggcggcgct
gagggcagcggacctccccgcgagggcgcctcggacgccagcatgcagcgcccgggcccc
gccnngtggctggtcctgcagnnggtgatgggctcgtgcgccgccatcagctccatggac
atgagcnngtcgggcgacggcaagtgccagcccatcgagatcccgatgtgcaaggacatc
ggctacaacatgacccgcatgcccaacctgatgggccacgagaaccagcgcgaggccgcc
atccagctgcacgagttcgcgccgctggtggagtacggctgccacggccacctccgcttc
ttcctgtgctccctgtacgcgcccatgtgcaccgagcaagtctccacccccatccccgcc
tgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatcatggagcagttcaac
ttcaagtggcccgactccctggactgcagcaaactccccaacaagaacgaccccaattac
ctgtgcatggaggcgcccaacaacggctcggacgagcccgcgcggggctcgggcatgttc
ccgccgctcttcaggccgcagcggccccacagcgcgcaggagcaccagctgaaggacggg
gcgccggggcgcgcgggctgcgacaacccgggcaagttccaccacgtggagaagagcgca
gcgtgcgcgccgctctgcacgccgggcgtggacgtctactggagccgcgacgacaagcac
ttcgccgtggtctggctggccgtctggtccgtgctctgcttcttctccagcgccttcacc
gtgctcaccttcctcatcgacccggcgcgcttcaggtaccccgagcgccccatcatcttc
ctctccatgtgctactgcgtctactccgtgggctacatcatccgcctctttgcgggcgcc
gagagcatcgcctgcgaccgggacagcggacagctctatgtcatccaggagggcctggag
agcacgggctgcaccctggtcttcctggtcctctactacttcggaatggccagctccctg
tggtgggtgatcctgacgctcacctggttcctggctgcgggcaagaagtggggccacgag
gccattgaggccaacagcagctacttccacctggcagcctgggccatccccgccgtgaag
accatcctgatcctggtgatgcgcagggtggcgggggacgagctgaccggcgtctgctac
gtgggcagcatggacgtcaacgccctcaccggcttcgtcctcatcccgctggcctgttac
ctcatcatcggcacttcctttattctctcgggctttgtggcccttttccacatccggagg
gtgatgaagacgggtggggagaacacggacaaactcgagaagctcatggtgaggatcggg
gtcttctccgtactctacacggtgccggccacctgtgtgattgcctgctacttttacgaa
cgcctcaacgtggagtactggaaggtcctggccacgcagcacgagtgcaaaatgaacaac
cagaccaaaaacctggactgtctgatggccgcctccatccccgcggtggagatcttcatg
gtgaaggtcttcatgttgctggtggtgggcatcaccagcggcatgtggatctggacatcc
aagactctgcagtcctggcagagtgtttgcagccgcaggttcaagaagaagagccgacgg
aaaccggccagcgtgatcaccaacagcgggatttacaaaaaagcccagcatcctcccaaa
acccgtctcgggaaatacgaaatccccgcccagcctcccacctgtgtgtga

KEGG   Camelus dromedarius (Arabian camel): 105093254
Entry
105093254         CDS       T04642                                 

Gene name
FZD8
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105093254 (FZD8)
   04390 Hippo signaling pathway
    105093254 (FZD8)
   04150 mTOR signaling pathway
    105093254 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105093254 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105093254 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093254 (FZD8)
   05205 Proteoglycans in cancer
    105093254 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105093254 (FZD8)
   05226 Gastric cancer
    105093254 (FZD8)
   05217 Basal cell carcinoma
    105093254 (FZD8)
   05224 Breast cancer
    105093254 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105093254 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    105093254 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105093254 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105093254 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105093254 (FZD8)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105093254 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR DUF2434
Other DBs
NCBI-GeneID: 105093254
NCBI-ProteinID: XP_031303235
LinkDB
Position
Unknown
AA seq 681 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDNNRTDLTTAAPSPPRRPPPPPPPGEQRPRQ
RPGRPPGXRPPSRGRGGGGTRLHPPARGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSER
HPLYNASRPXQIAKLRVPCHNPFFSXDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMER
FKYPERPXIISSACYLFVSVGTWCAWWRATEGGVCSGGAGPGGGGVRGGGRGGRGAAGAG
AGGPGGRGXEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAA
GMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFV
XAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAA
VVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVW
SGKTLESGARVHPCCWASKGAGAAGXGGGGPGGGGAGPGGGAGGPGGGAGSLYSDVSTGL
TWRSGTASSVSYPKQMPLSQV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgttgctggccgccctggcgctgctgcag
cgctctagcggcgcggcggccgcctcagctaaggagctggcgtgccaggagatcaccgtg
cctctgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagcccctgcctccctgccggtcggtgtgcgagcgcgccaaggccggctgcgcgccc
ctcatgcggcagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgag
cagggcaaccccgacacgttgtgcatggacaacaaccgcacggacctcaccacggccgcg
cccagcccgccgcgccgcccgccgccgccgccgccgcccggcgagcagcgccctcggcag
cggccaggtcgcccgccggggnncaggcccccatcccgcggccggggcggcggggggacg
cggctgcaccccccagcgcgcggcggcggcgggaaggcgcggccccctggcggcggcgcg
gcgccctgcgagccggggtgccagtgccgcgcgcccatggtgagcgtgtccagcgagcgg
caccctctctacaacgcgtcaagaccgnngcagatcgccaaactgcgcgtgccctgccac
aatccgtttttcagcncggacgagcgcgccttcactgtcttctggatcggcctgtggtcg
gtgctctgcttcgtgtccaccttcgccaccgtgtccaccttcctcatcgacatggagcgc
ttcaagtaccccgagcggcccnncatcatctcttcggcctgctacctcttcgtgtccgtc
ggtacctggtgcgcctggtggcgggccacggaaggtggcgtgtgcagcggtggcgcgggg
ccggggggggggggggtgcgagggggcggccgcggcgggcggggcgcagcgggcgcgggc
gcaggcggcccgggcgggcgcggctgagagtacgaggagctgggcgcagtcgagcagcac
gtgcgctacgagaccaccgggccggctctgtgcaccgtggtcttcctgctcgtctacttc
ttcggcatggccagctccatctggtgggtgatcctgtcgctcacgtggttcctggcggcg
ggcatgaagtggggtaacgaagccatcgccggctactcgcagtacttccacctggccgcg
tggctcgtgcccagcgtcaagtccatcgccgtgctggcgctcagctcggtggacggcgac
ccggtggcgggcatctgctacgttggcaaccagagcctggacaacctgcgcggcttcgtg
ntggcgccgctggtcatctacctcttcatcggcaccatgttcctgctggccggcttcgtg
tctctcttccgcatccgctcggtcatcaagcagcagggcggccctaccaagacgcacaag
ctggagaagctcatgatccgcctgggcctcttcaccgtgctctacaccgtgcccgccgcc
gtcgtggtcgcttgcctcttctacgagcagcacaaccgcccgcgctgggaggccacgcac
aactgtccgtgcctgcgggacctgcagccggaccaggcgcgccggcccgactacgccgtc
ttcatgctcaagtacttcatgtgcctggtggtgggcatcacctccggcgtgtgggtctgg
tcgggcaagacgctcgagtcgggcgcgcgtgtgcacccgtgctgctgggccagcaaaggc
gcgggcgcggcgggcnggggggggggcggcccggggggcggcggcgcggggcccggcggc
ggggcgggggggccgggcggcggggcgggctccctctacagcgacgtcagcaccggcttg
acgtggcggtcgggcacggccagctccgtgtcgtatccaaagcagatgcccttgtcccag
gtctga

KEGG   Camelus dromedarius (Arabian camel): 105093559
Entry
105093559         CDS       T04642                                 

Gene name
FZD5
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-5
  KO
K02375  frizzled 5/8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105093559 (FZD5)
   04390 Hippo signaling pathway
    105093559 (FZD5)
   04150 mTOR signaling pathway
    105093559 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105093559 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105093559 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093559 (FZD5)
   05205 Proteoglycans in cancer
    105093559 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105093559 (FZD5)
   05226 Gastric cancer
    105093559 (FZD5)
   05217 Basal cell carcinoma
    105093559 (FZD5)
   05224 Breast cancer
    105093559 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105093559 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    105093559 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105093559 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105093559 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105093559 (FZD5)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105093559 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 105093559
NCBI-ProteinID: XP_031307769
LinkDB
Position
5
AA seq 595 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGQPGPASGGD
CAAGGPAMCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGL
WSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE
HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFH
LAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLAPLVLYLLVGTLFLLA
GFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAA
LTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTXRCCCRR
PRRGHKSGGATAAGDYEASAALTGRTGTPGPAAAAAAAAAAAAAAYHKQVSLSHV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgctccgccttcgctgttgctattgcttctggcgcagctg
gcgggccgggcggcggccgcctccaaggccccggtgtgccaggaaatcacagtgcccatg
tgccgcggcatcggctataacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggtctggaggtgcaccagttctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgccggactaccacaag
ccgctgccgccctgccgctccgtgtgtgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggccggaacgcatgagctgcgaccgcctcccagtgctgggc
cgcgacgccgaggtcctgtgcatggattacaatcgcagcgaggccaccacggcgcccccc
aggcccttcccggccaaacccaccctcccaggccagccggggccagcctcggggggcgac
tgcgccgccgggggcccagcgatgtgcaagtgccgcgaacccttcgtgcccattctgaag
gagtcgcacccgctttacaacaaggtgcggaccggccaggtacccaactgtgcggtaccc
tgctaccagccgtccttcagccccgacgagcgcacgttcgccaccttctggatcggcctg
tggtctgtgctgtgcttcatctccacttccaccacggtggccaccttcttaatagacatg
gaacgcttccgttaccctgagcgccccatcatcttcttgtcagcctgctacctgtgcgtg
tcgctgggcttcctggtgcgcctggtcgtgggccatgccagcgtcgcctgcagccgcgag
cacagccacatccactatgagacaacgggccctgcgctgtgcactgttgtctttttactg
gtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctggttc
ttggcggctggcatgaagtggggcaacgaggctattgcaggctatgcgcagtacttccac
ctggccgcgtggctcattcccagtgtcaagtccatcactgcactggcactgagctccgtg
gatggggacccggtggccggcatctgctacgtggggaaccagaacctgaactcgctacgc
ggcttcgtgctggccccgctggtgctctacctgctggtgggcacgctcttcctcctggcc
ggcttcgtgtctctcttccgcatccgcagcgtcatcaagcagggtggcaccaagacggac
aagctggagaagctcatgatccgtattggcatcttcacactactctacacggtgcccgcc
agcatcgtggtggcctgctacctgtacgaacagcattatcgcgagagttgggaggctgcg
ctcacctgcgcgtgcccaggtccagatgccggccagccgcgcgccaagcccgagtactgg
gttctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctggatt
tggtccggcaagactgtggagtcgtggcgccgcttcacanngcgctgctgctgccgccgc
ccgcggcggggccacaagagcggcggcgccactgctgccggggactacgaggcgagcgca
gctctcactggcaggaccgggacgccgggccccgccgccgccgccgctgccgccgccgcc
gccgccgccgccgcctaccacaagcaggtgtccttgtcgcacgtgtag

KEGG   Camelus dromedarius (Arabian camel): 105094444
Entry
105094444         CDS       T04642                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105094444 (FZD2)
   04390 Hippo signaling pathway
    105094444 (FZD2)
   04150 mTOR signaling pathway
    105094444 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105094444 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105094444 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094444 (FZD2)
   05205 Proteoglycans in cancer
    105094444 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105094444 (FZD2)
   05226 Gastric cancer
    105094444 (FZD2)
   05217 Basal cell carcinoma
    105094444 (FZD2)
   05224 Breast cancer
    105094444 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105094444 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    105094444 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105094444 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105094444 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105094444 (FZD2)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105094444 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 105094444
NCBI-ProteinID: XP_031324479
LinkDB
Position
16
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagtgccctgccccgcctgctgctgccgctgctgctgctgcctgccgcc
gggccagcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatccctctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcgggcctggaggtgcaccagttctacccgttggtg
aaggtgcagtgctcgcccgaactgcgcttcttcttgtgctccatgtacgcacccgtgtgc
acggtgctggagcaggccatccctccgtgccgctccatctgtgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcggtttccagtggccggagcgcctgcgctgcgagcat
ttcccccgccacggcgcggagcagatctgcgtgggccagaaccactcggaggacggcgca
ccagcgctgctcaccaccgcgcccccgccgggcctgcagccgggtgcagggggcaccccg
ggcggcccgggcggcggcggttcgcccccgcgctacgccacgctggagcacccgttccac
tgcccgcgtgtcctcaaggtgccgtcctatctcagctacaagttcctcggcgagcgcgac
tgcgcggcgccctgcgagccggcccggcccgatggctccatgttcttctcgcaggaggag
acacgctttgcgcgtctgtggatcctcacctggtcggtgttgtgctgcgcttccaccttc
ttcaccgtcaccacgtacctggtggacatgcagcgcttccgctaccccgagcggcccatc
atctttctgtccggctgctatactatggtatcggtagcctacatcgccggtttcgtgctt
caggagcgcgtagtgtgcaacgagcgcttctccgaggacggctatcgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agttccatctggtgggtcatcctgtcgctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtacttccacctggccgcgtgggccgtgccc
gcggtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgttgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcgaggcttcgtgctagcgccgctc
ttcgtatacctgttcataggcacgtccttcctcctggccggtttcgtgtccctcttccgc
atccgtaccatcatgaagcacgacggcaccaagacagagaagctggagcggctcatggtg
cgcatcggcgtcttctcggtgctctacaccgtgcccgccaccatcgtcatcgcctgctac
ttctacgagcaggccttccgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcacactacacgccgcgcatgtcgcccgacttcacagtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggtaagacgctgcactcgtggaggaagttctacacgcgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Camelus dromedarius (Arabian camel): 105097946
Entry
105097946         CDS       T04642                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105097946 (FZD4)
   04390 Hippo signaling pathway
    105097946 (FZD4)
   04150 mTOR signaling pathway
    105097946 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105097946 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105097946 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105097946 (FZD4)
   05205 Proteoglycans in cancer
    105097946 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105097946 (FZD4)
   05226 Gastric cancer
    105097946 (FZD4)
   05217 Basal cell carcinoma
    105097946 (FZD4)
   05224 Breast cancer
    105097946 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105097946 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    105097946 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105097946 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105097946 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105097946 (FZD4)
   04090 CD molecules [BR:cdk04090]
    105097946 (FZD4)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105097946 (FZD4)
CD molecules [BR:cdk04090]
 Proteins
  105097946 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 105097946
NCBI-ProteinID: XP_010988886
UniProt: A0A5N4DL85
LinkDB
Position
10
AA seq 537 aa
MAGRGAGLRVLGAPGGVGLSLRLLLLLLVLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPVQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLHSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGRVKREKRGNGWVKPGRGSETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggccgggaggggcgcagggctgcgcgtcctgggggctcccgggggtgtcggtctcagt
ctgcggctgctgctgctgttgctggtgctcctggggccggcgcggggcttcggagacgag
gaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgctgagctgcagctgact
actttcacgccgctcatccagtacggttgctccagccagctgcagtttttcctttgttcg
gtgtatgtgccgatgtgcacagagaaggtcaacatcccgatcggcccctgtggcggcatg
tgtctttctgtcaagagacgctgcgagcctgtcctgaaggaatttggatttgcctggccg
gagagcctgaactgcagcaagttccccccacagaatgaccacaaccacatgtgcatggaa
gggccaggtgatgaggaggtgcccttacctcacaaaacccccgtccagcccggggaagag
tgccattccgtgggaaccaattctgatcagtacatctgggtgaagaggagcctgaactgt
gttctcaagtgtggctacgatgctggcttacacagccgctcggccaaggagttcaccgat
atctggatggccgtgtgggccagcctgtgcttcatctccaccgccttcactgtgctcacc
ttcctgatcgattcttccaggttttcctacccggagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtcggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgg
gtaattctgacactcacttggtttttggcagcgggactcaaatggggtcacgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggccatccctgcagtgaagaccatt
gtcatcttgattatgagactggtggatgccgatgaactgaccggcctgtgctatgtgggg
aaccaaaacttggatgcccttacgggttttgtggtggctcccctcttcacttacctggtg
atcggaactttgttcattgctgcgggtttggtggccttgttcaaaattcggtcgaatctt
caaaaggatgggacaaagacagacaagttagaaaggctcatggttaagattggggtcttc
tcagtcctgtacacagtgcccgcaacctgtgtgattgcctgttatttctatgaaatctcc
aactgggcgctctttcggtattctgcagatgattccaatatggcggttgaaatgttgaaa
atttttatgtctttgctggtaggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctgggagggtaaagagagaa
aagagagggaatggttgggtgaagcccgggagaggcagtgaaactgtggtataa

KEGG   Camelus dromedarius (Arabian camel): 105098968
Entry
105098968         CDS       T04642                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105098968 (FZD7)
   04390 Hippo signaling pathway
    105098968 (FZD7)
   04150 mTOR signaling pathway
    105098968 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105098968 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105098968 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105098968 (FZD7)
   05205 Proteoglycans in cancer
    105098968 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105098968 (FZD7)
   05226 Gastric cancer
    105098968 (FZD7)
   05217 Basal cell carcinoma
    105098968 (FZD7)
   05224 Breast cancer
    105098968 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105098968 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    105098968 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105098968 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105098968 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105098968 (FZD7)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105098968 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 105098968
NCBI-ProteinID: XP_010990033
LinkDB
Position
5
AA seq 574 aa
MRGPRAAASRSPLGLCTLVLALLGALPAGARAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYMPDLPFTALSPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggtccccgcgcggcagcgtcgcgctcgcctttgggcctgtgcactctggtgctt
gcgctgctgggcgcactgcccgcgggcgccagggcgcagccgtaccacggcgaaaagggc
atctcagtgccagaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatactgcccaatctgctgggtcacacaaaccaagaggacgcaggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctgcgcttc
ttcctctgctccatgtacgcacccgtgtgcaccgtgctggataaggccatcccgccgtgc
cgatctctgtgcgagcgtgcccgccagggctgcgaggctctcatgaacaagttcggcttc
caatggccggagcggctgcgttgcgagaacttccccgtgcacggcgcgggggagatctgc
gtgggccagaacacgtccgacggctccgggggccctggcggcggccccaccgcttacccc
accgcgccctacatgcccgacctgcccttcaccgccctgtccccgggtgccgctgacggt
aggggccgctccgctttccccttctcgtgcccccgccagctcaaggtgcccccctacctg
ggctaccgctttctgggcgagcgcgactgcggcgccccttgcgagccgggccgtgccaac
ggcctcatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggagtgtgg
tcggtgctgtgctgcgcctcgacgctcttcaccgtgctcacctacctagtggacatgcgg
cgcttcagctacccggagcggcccatcatcttcctttcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttcctgctggaggaccgcgccgtgtgcgtggagcgcttctca
gacgacggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatccttttc
atggtgctctacttcttcggcatggccagttccatctggtgggtcattttgtcgctcact
tggttcctggcggccggtatgaagtggggccacgaggccatcgaagccaactcgcagtac
ttccacctggccgcgtgggcagtgcccgccgtcaagactatcaccatcctggccatgggc
caggtggacggggacctgctcagcggggtgtgctacgtgggcctgtccagcgtggacgcg
ctgcgaggctttgtgctggcacccctgttcgtctacctcttcatcggcacgtccttcctg
ctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaagcacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacaccgtg
ccggccaccatcgtcctggcctgttacttttacgagcaggccttccgcgaacactgggag
cgcacctggctcctgcagacgtgcaagagctacgcggtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgta
ggcatcaccactggcttctggatctggtccggcaaaaccctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgcagtatga

KEGG   Camelus dromedarius (Arabian camel): 105102079
Entry
105102079         CDS       T04642                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105102079 (FZD3)
   04390 Hippo signaling pathway
    105102079 (FZD3)
   04150 mTOR signaling pathway
    105102079 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105102079 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105102079 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    105102079 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102079 (FZD3)
   05206 MicroRNAs in cancer
    105102079 (FZD3)
   05205 Proteoglycans in cancer
    105102079 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105102079 (FZD3)
   05226 Gastric cancer
    105102079 (FZD3)
   05217 Basal cell carcinoma
    105102079 (FZD3)
   05224 Breast cancer
    105102079 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102079 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    105102079 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105102079 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105102079 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105102079 (FZD3)
G protein-coupled receptors [BR:cdk04030]
 Frizzled / Smoothened family
  105102079 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 105102079
NCBI-ProteinID: XP_031298012
LinkDB
Position
31
AA seq 666 aa
MAMSWIVFYLWPLTMFVAHIDGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSVRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggatcgtcttctatctgtggcccttgactatgtttgtggcgcatata
gatgggcacagtctgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttttgaatcattatgaccaacagacagcggcttta
gcaatggagccattccatcccatggtgaatctggattgttctcgggatttccggccattt
ctttgtgcactctatgctccgatttgtatggaatatggacgtgtcacacttccctgccgt
aggctgtgtcagcgggcttacagcgagtgttcaaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtaccctcgactt
gtggatctgaatttagctggagatcctaccgaaggagccccagtggctgtgcagagggac
tatggtttttggtgtcctcgagagttgaaaattgatcctgatcttggttattcctttttg
cacgtacgtgattgttcacctccttgtccgaatatgtacttcaggagagaagaactttca
tttgctcgatatttcataggattgatttcaatcatttgcctctctgcgacgttgtttacc
tttttaacttttttgattgatgtcacgagattccgctatcctgaaagacctattatattt
tatgcagtatgctacatgatggtatcattaatattcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcacaataaagcatgtaccatgctttttatggtactctatttttttactatggctggc
agcgtttggtgggtaattcttaccatcacatggttcttggcagctgtgcccaagtggggt
agtgaagctattgagaagaaagcgctgctatttcacgccagtgcatggggcatccctgga
actctaactatcatccttttagccatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgacgccttgaggtattttgttcttgcacccctctgc
ctgtatgtggtagttggggtttcactcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggcgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcgtaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaagtacctgatggctctcatagttggtattccttccattttttgggttggaagc
aagaagacatgcttcgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtacttcaggaacctgattttgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacatccactcatgct
tcttcaacgcaactggctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccacggcagcctccacaggtcccgtgatggcaggtatactccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacggctaacagaccac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacacagcagcgtccgagat
ctcagtaacaaccctatgacccacatcacacatggcaccagtatgaatcgggttattgaa
gaagatggaaccagtgcttaa

DBGET integrated database retrieval system