Camelus dromedarius (Arabian camel): 105087463 Help Entry 105087463         CDS       T04642                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk03008   Ribosome biogenesis in eukaryotes cdk03083   Polycomb repressive complex cdk04064   NF-kappa B signaling pathway cdk04137   Mitophagy - animal cdk04310   Wnt signaling pathway cdk04520   Adherens junction cdk05010   Alzheimer disease cdk05020   Prion disease cdk05022   Pathways of neurodegeneration - multiple diseases cdk05162   Measles cdk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cdk00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     105087463 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     105087463 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105087463 (CSNK2B)    04064 NF-kappa B signaling pathway     105087463 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105087463 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     105087463 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105087463 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     105087463 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     105087463 (CSNK2B)    05020 Prion disease     105087463 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     105087463 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:cdk03009]     105087463 (CSNK2B)    03036 Chromosome and associated proteins [BR:cdk03036]     105087463 (CSNK2B) Ribosome biogenesis [BR:cdk03009]  Eukaryotic type   90S particles    Kinase     105087463 (CSNK2B) Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      105087463 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  105087463 NCBI-ProteinID:  XP_010976435 LinkDB All DBs Position 20:complement(22373885..22377966) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgag gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgaaatgctctat ggattgatccacgcccgctacatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagattcatccgatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system