KEGG   Camelus dromedarius (Arabian camel): 105088132
Entry
105088132         CDS       T04642                                 

Definition
(RefSeq) diazepam-binding inhibitor-like 5
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105088132
SSDB
Motif
Pfam: ACBP
Other DBs
NCBI-GeneID: 105088132
NCBI-ProteinID: XP_010977222
LinkDB
Position
16
AA seq 87 aa
MCQVEFEMACAAIKQLKGPVSDREKLLVYSFYKQATQGDCNIPAPPATDVKAKAKWVAWN
ENKGMSKMDAMRIYIAKVEELKKNEAG
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtgccaagtggagtttgaaatggcctgcgctgctatcaagcagttgaaagggccggtg
agtgatcgggagaaattgttggtgtacagcttctacaaacaggccactcagggcgactgc
aacatccctgccccgcctgccaccgatgtgaaagccaaggccaagtgggtggcgtggaat
gagaacaaagggatgtccaagatggatgccatgaggatctatattgccaaagtggaagaa
ctaaagaaaaatgaagctggctag

KEGG   Camelus dromedarius (Arabian camel): 105088426
Entry
105088426         CDS       T04642                                 

Gene name
DBI
Definition
(RefSeq) acyl-CoA-binding protein
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105088426 (DBI)
SSDB
Motif
Pfam: ACBP
Other DBs
NCBI-GeneID: 105088426
NCBI-ProteinID: XP_010977568
UniProt: A0A5N4E7I5
LinkDB
Position
5
AA seq 87 aa
MSQAEFEKAAEEVKHLKTKPADDEMLFIYSHYKQATVGDVNTERPGMLDFKGKAKWDAWN
ELKGTSKEDAMKAYVNKVEELKKKYGM
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtctcaggctgagtttgagaaagctgctgaggaagttaaacacctcaagaccaagccg
gcagatgatgagatgctgttcatctacagccactacaaacaagcgaccgtgggtgacgtg
aatacagaacggcctggaatgttggacttcaaaggcaaggccaagtgggatgcctggaat
gagctgaaagggacttccaaggaagatgccatgaaagcttacgtcaacaaagtagaagaa
ctaaagaaaaaatacggaatgtaa

DBGET integrated database retrieval system