KEGG   Camelus dromedarius (Arabian camel): 105088938
Entry
105088938         CDS       T04642                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: casein kinase I-like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04340  Hedgehog signaling pathway
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105088938
   04340 Hedgehog signaling pathway
    105088938
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105088938
   05226 Gastric cancer
    105088938
   05224 Breast cancer
    105088938
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105088938
   05022 Pathways of neurodegeneration - multiple diseases
    105088938
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105088938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105088938
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105088938
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105088938
SSDB
Motif
Pfam: Pkinase Pkinase_fungal PK_Tyr_Ser-Thr Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 105088938
NCBI-ProteinID: XP_031323083
LinkDB
Position
15
AA seq 236 aa
MDLLGPSLKDLFNFCSRRFTMKIVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRH
CDKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYVSISAHLGIEQSRRDDMESLGY
VLMYFNRTSLPWQGLKAATKKQKYEKISEKKISTPVEVLCKGFPAEFAMYLNYCRGLRFE
EVPDYMYPRQLFRILFRTLKHQHDYTFDWTTLKQRXAQQAASSSGQGQQAQMPTGF
NT seq 711 nt   +upstreamnt  +downstreamnt
atggatcttcttggacccagcctcaaagacctcttcaatttctgttcaagaaggttcaca
atgaaaattgtacttatgttagccgaccagatgatcagtagaattgaatatgtgcataca
aagaattttatacacagagacattaaaccagataacttcctaatgggtattgggcgtcac
tgtgataagttattccttattgactttggtttggccaaaaagtacagagacaacaggact
aggcaacacataccttacagagaagataaaaatctcactggcactgctcgatatgttagc
atcagtgcacatcttggtattgaacagagtcgccgagatgacatggagtcactaggatat
gttttgatgtattttaatagaaccagcctgccatggcaaggactaaaggctgcaacaaag
aagcaaaaatatgaaaaaattagcgaaaagaagatatccacacctgttgaagttttatgt
aaggggtttcctgcagaatttgccatgtacttaaactattgtcgtgggctgcgctttgag
gaagtcccggattacatgtacccgaggcagctattccgcattcttttcaggaccctgaag
caccaacatgactacacatttgactggacaacgttaaagcagagangagcacagcaggca
gcctcttcaagtgggcagggtcagcaggcccaaatgcccacaggtttctaa

KEGG   Camelus dromedarius (Arabian camel): 105097024
Entry
105097024         CDS       T04642                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04340  Hedgehog signaling pathway
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105097024 (CSNK1A1)
   04340 Hedgehog signaling pathway
    105097024 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105097024 (CSNK1A1)
   05226 Gastric cancer
    105097024 (CSNK1A1)
   05224 Breast cancer
    105097024 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105097024 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    105097024 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105097024 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105097024 (CSNK1A1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105097024 (CSNK1A1)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105097024 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 105097024
NCBI-ProteinID: XP_010987783
LinkDB
Position
3
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatttacctggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaaactctataagattcttcaaggtggggtcggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtgctagtcatggatcttcttggacccagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggactaggcaacac
ataccttacagagaagataaaaatctcactggcactgctcgatatgctagcatcaatgca
catcttggtattgaacagagtcgccgagatgacatggagtcattaggatatgttttgatg
tactttaatagaaccagcctgccatggcaaggactaaaggctgcaacaaagaagcaaaaa
tatgaaaaaattagcgaaaagaagatgtccacacctgttgaagttttatgtaaggggttt
cctgcagaatttgccatgtacttaaactattgtcgtgggctgcgctttgaagaagccccg
gattacatgtacctgaggcagctattccgcattcttttcaggaccctgaatcaccaatat
gactacacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttca
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system