KEGG   Camelus dromedarius (Arabian camel): 105090254
Entry
105090254         CDS       T04642                                 

Gene name
TCF7
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7
  KO
K02620  transcription factor 7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05132  Salmonella infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105090254 (TCF7)
   04390 Hippo signaling pathway
    105090254 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105090254 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    105090254 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105090254 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090254 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105090254 (TCF7)
   05225 Hepatocellular carcinoma
    105090254 (TCF7)
   05226 Gastric cancer
    105090254 (TCF7)
   05216 Thyroid cancer
    105090254 (TCF7)
   05221 Acute myeloid leukemia
    105090254 (TCF7)
   05217 Basal cell carcinoma
    105090254 (TCF7)
   05215 Prostate cancer
    105090254 (TCF7)
   05213 Endometrial cancer
    105090254 (TCF7)
   05224 Breast cancer
    105090254 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105090254 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090254 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105090254 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    105090254 (TCF7)
   05165 Human papillomavirus infection
    105090254 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105090254 (TCF7)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    105090254 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 Peptidase_M13
Other DBs
NCBI-GeneID: 105090254
NCBI-ProteinID: XP_031304875
LinkDB
Position
3
AA seq 383 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPSHGVPQLSPLYEHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIP
HPAIVPPSGKQELQPYDRSLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECT
LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREK
HQESNTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRCPSPVPSDDSALGCP
GSPAPQDSPSYLLLPHFPTELLASPAEQHLHHQVSRPLSASQTLGPLRPLTATYRAQRYS
NRSLRDRQPSVHRTHSLLQGSAL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccacccccctcg
ggagcagggcaacatccccagccgcagccaccgctgcacaacaaggccagtcagccttcc
catggcgttccccaactctctcctctctatgaacatttcagcagcccacaccccacacca
gcaccagccgacatcagccagaagcaaggagttcacaggcctctgcagacccctgacctc
tctggcttctactctctgacctcaggcagcatgggacagctcccccacactgtgagctgg
ttcacccacccatccctgatgttaggctctggtgtacctggtcaccccgcagccattccc
cacccagccattgtgcccccttcagggaagcaggagctgcagccctatgaccgcagcctg
aagacacaggcagaatccaaggcagagaaggaggccaagaagccaaccatcaagaagcca
ctcaatgccttcatgctgtacatgaaggagatgagagccaaggtcattgcagaatgcacg
ctcaaggagagcgctgccatcaaccaaatcttgggccgcaggtggcacgcactgtcgcga
gaagagcaggccaaatattatgagctggcccgcaaggagaggcagctgcacatgcagcta
tacccaggctggtcggcgcgggacaactatgggaagaagaagaggcggtcaagggagaag
caccaagaatccaacacagaccctggctcgcctaagaaatgccgtgctcgctttggcctc
aaccagcagacggattggtgtggtccatgcaggaggaaaaagaaatgcattcggtactta
cccggagaaggccgctgccccagccccgttccttccgatgacagtgctctaggctgcccc
gggtccccagccccccaggactcgccctcatacctcctgctgccccactttcccacagaa
ctgcttgctagccctgcggagcagcacctacatcaccaggtctctcggccactctcagcc
tcccagaccttgggccccctcaggcccctcacagcgacctacagagcacagaggtacagc
aacaggagcctcagagacaggcagcctagcgtgcacaggacacacagcctcctccagggg
tccgccctctga

KEGG   Camelus dromedarius (Arabian camel): 105091689
Entry
105091689         CDS       T04642                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05132  Salmonella infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105091689 (TCF7L2)
   04390 Hippo signaling pathway
    105091689 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105091689 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105091689 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091689 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105091689 (TCF7L2)
   05225 Hepatocellular carcinoma
    105091689 (TCF7L2)
   05226 Gastric cancer
    105091689 (TCF7L2)
   05216 Thyroid cancer
    105091689 (TCF7L2)
   05221 Acute myeloid leukemia
    105091689 (TCF7L2)
   05217 Basal cell carcinoma
    105091689 (TCF7L2)
   05215 Prostate cancer
    105091689 (TCF7L2)
   05213 Endometrial cancer
    105091689 (TCF7L2)
   05224 Breast cancer
    105091689 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105091689 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105091689 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105091689 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    105091689 (TCF7L2)
   05165 Human papillomavirus infection
    105091689 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105091689 (TCF7L2)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    105091689 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 105091689
NCBI-ProteinID: XP_031317618
LinkDB
Position
11
AA seq 521 aa
MKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVF
RDMKRSHSLQKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVD
PKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALT
VNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSK
KEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSA
PKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPSSPHLLGSP
PQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHGKAPALCANGALDLPHAA
LQPPAIPSASLAQPSTSSLHSHNSLAGTQPQPLSLVTKSLE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaaatggccactgctggacgttcaggcggggaccctccagagcagacaagccctcaag
gatgcccgctctccgtcgccagcacacattgttcagtgccccctcccttgctgcactcag
ggacatgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttc
agggacatgaaaaggagccactccttacaaaaggttggggagccctggtgtttggagtcg
aacaaagtgccggttgtgcagcaccctcaccatgtccaccctctcacgcctcttatcacg
tacagcaatgaacacttcacgccgggaaacccacctccacacttaccagctgacgtagac
cccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattacccactc
tcgcctggcaccgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggt
cagcccgtgtatccaatcacgacaggaggattccgtcatccctaccccacagctctgact
gtcaacgcttccatgtccagctttctgtcttctaggttccctccccacatggtcccaccc
catcacactctacacacgactggcatccctcacccggccatagtcacgccaacagtcaaa
caggaatcctcccagagtgacgtcggctcactccatagcgcaaagcatcaggactctaaa
aaggaagaagagaagaagaagccccacataaagaaacctcttaacgcgttcatgttgtat
atgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaagaaagcgcagccatc
aaccagatcctgggccgaaggtggcatgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcacatgcagctgtaccccggctggtccgcacgg
gataactatgggaagaagaagaagaggaaaagggacaagcagcccggggagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccc
tcttcagatggaagcttactagactcgcctccttcctccccccacctgctaggctcccct
ccccaagacgccaagtcacagactgagcagacccagcctctctcgctgtccctgaagccc
gaccccctggcccacctctccatgatgcctccgccgcccgccctcctgcttgcggaggcc
gcccacggcaaggcccccgcgctctgcgccaacggggccctggacctgccccacgccgcg
ctgcagcctcccgccatcccctccgcatctctggcacagccgtcaacatcttccttacat
tcccacaactctctggccgggacccagccccagccgctctccctggtcaccaagtcttta
gaataa

KEGG   Camelus dromedarius (Arabian camel): 105104146
Entry
105104146         CDS       T04642                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05132  Salmonella infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105104146 (TCF7L1)
   04390 Hippo signaling pathway
    105104146 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105104146 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105104146 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105104146 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105104146 (TCF7L1)
   05225 Hepatocellular carcinoma
    105104146 (TCF7L1)
   05226 Gastric cancer
    105104146 (TCF7L1)
   05216 Thyroid cancer
    105104146 (TCF7L1)
   05221 Acute myeloid leukemia
    105104146 (TCF7L1)
   05217 Basal cell carcinoma
    105104146 (TCF7L1)
   05215 Prostate cancer
    105104146 (TCF7L1)
   05213 Endometrial cancer
    105104146 (TCF7L1)
   05224 Breast cancer
    105104146 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105104146 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105104146 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105104146 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    105104146 (TCF7L1)
   05165 Human papillomavirus infection
    105104146 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105104146 (TCF7L1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    105104146 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 105104146
NCBI-ProteinID: XP_031296841
LinkDB
Position
28
AA seq 630 aa
CGPRAASGAGGEREEGGRGRPGGPGRARAARGSRAAAPARGPPCPTAVAAARQRGRRRRR
RRLGAPGGRGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSS
SSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLPNG
PLSPGGARTYLQMKWPLLDVPASATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYS
NDHFSPGSPPAHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQP
MYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQE
PAPPSLSPAVSAKSPVPVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQ
ILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQP
QAQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSE
QAQPLSLTTKPETRAQLALHSAAFLSGKAAATSSGQMGSQPPLLSRPLPLGSMPTALLTS
PPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1893 nt   +upstreamnt  +downstreamnt
tgcggcccgcgggcggcgagcggagcgggcggcgagcgggaggaaggagggagggggcgg
ccgggcgggccggggcgggcgcgggcggcgaggggctcgagagcagcggccccggcccgc
ggcccaccatgccccacggcggtggcggcggcgcggcagcgggggaggcggcggcggcgg
cggcggctcggggcgccggggggccggggaggggacgacctcggggccaacgacgagctg
atccccttccaggatgaggggggcgaggagcaggagccgagcagcgacagcgcctcggcg
cagcgggacctggacgaggtgaagtcgtccctggtcaacgagtcggagaaccagagcagc
agctcggactcggaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccg
cgggactatttcgccgaagtgagaaggccccaggacggcgcgttctttaagggcccccct
taccctgggtacccgtttctgatgatcccggacctgagcagcccgtacctccccaacgga
cccctgtctcccggaggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtc
cccgccagtgccacagtcaaggacaccagatcgccgtcccccgcacacttgtcgaacaaa
gtccctgttgttcagcacccgcatcacatgcacccgttgacgcctctcatcacctacagc
aacgaccacttctcccccggctcccctcccgcacacctgtccccagagatcgatccaaag
acaggaatccctcggccccctcacccatctgagctgtctccgtattacccactgtctccc
ggagctgtcggacaaatcccccatcccctcggctggctcgtcccacagcaaggacagccc
atgtactcccttcctcctggtggcttccggcacccctaccctgccctcgccatgaacgcc
tcgatgtccagcctggtttccagtcggttctcccctcacatggtggctccggcccatcct
ggtctgcccacctcagggatcccccaccccgccatcgtctcccccatcgtgaagcaggaa
ccggcgccccccagcctgagcccggcagtgagcgcgaaatcgccagttccagtgaaaaaa
gaggaagaaaagaaaccccacgtgaagaagcctcttaatgccttcatgttgtacatgaag
gagatgagggccaaggtggtggccgagtgcaccctgaaggagagtgcggccattaaccag
atcctggggagaaagtggcacaacctgtcccgagaagagcaggccaagtactacgaactg
gcccggaaggagcggcagcttcactcgcagctctacccgacctggtcagcccgggacaac
tatggtaagaaaaagaagaggaagcgagaaaagcagctgtcgcagacccagtcccagccg
caagcccaggaagcagaaggtgctctggcctccaaaagcaagaagccatgtgttcagtac
ctgccgcctgagaagccctgtgacagccccgcctcctcccacggcagcatgctggactcc
ccagccaccccctccgcggccctggcctcgccggccgccccggccgccacccactcggag
caagcgcagcccctctccctcaccaccaagccagagacccgggcccagctggcgctccac
tcggcggccttcctgtcagggaaggcggcggccacctcctctgggcagatgggcagccag
cccccactcctgtcccggcccctgcccctggggtccatgcccacagctctgctgacgtcc
cccccctccttcccagccacgctccatgcccaccaggccctccccgttctccaggcccag
cctctttccttggtcaccaagtctgcccactga

KEGG   Camelus dromedarius (Arabian camel): 105105289
Entry
105105289         CDS       T04642                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05132  Salmonella infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105105289 (LEF1)
   04390 Hippo signaling pathway
    105105289 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105105289 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105105289 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105105289 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105105289 (LEF1)
   05225 Hepatocellular carcinoma
    105105289 (LEF1)
   05226 Gastric cancer
    105105289 (LEF1)
   05216 Thyroid cancer
    105105289 (LEF1)
   05221 Acute myeloid leukemia
    105105289 (LEF1)
   05217 Basal cell carcinoma
    105105289 (LEF1)
   05215 Prostate cancer
    105105289 (LEF1)
   05213 Endometrial cancer
    105105289 (LEF1)
   05224 Breast cancer
    105105289 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105105289 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105105289 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105105289 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    105105289 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105105289 (LEF1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    105105289 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 105105289
NCBI-ProteinID: XP_010997366
LinkDB
Position
2
AA seq 414 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggcgggggggacccggaactctgcgccacg
gacgagatgattcccttcaaggacgagggcgatccccagaaggagaagatcttcgccgaa
atcagtcaccctgaggaggaaggtgacttagccgacatcaagtcctccttggttaacgag
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacttctcag
gagtcctaccatgacaaagccagagaacaccctgatgaaggaaagcatccagatggaggc
ctctacaacaagggaccctcttactcgagttattcagggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcagtccatcctctcacccccctcatcacttac
agcgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aagcaaggcatgtccagacatcctccagctcctgagatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggaggattcaggcaaccctacccatcctcactgtcagtggacacttccatgtcc
aggttttctcatcatatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctattgtaacgcctcaggtcaaacaggaacacccccacactgacagcgacctaatg
cacgtgaagcctcagcatgaacagaggaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagcggag
tgtactctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcacgccctc
tcccgtgaagaacaggctaaatattatgaattagcacggaaggagagacagctccacatg
cagctctacccaggctggtcggccagagacaactacggtaagaaaaagaagaggaagaga
gagaaactgcaggaatctacatcaggtggaaaacgaagctcattcccaacgtgcaaagcc
aaggcagcgaccccaggacctcttctggagatggaagcttgttga

DBGET integrated database retrieval system