KEGG   Camelus dromedarius (Arabian camel): 105090699
Entry
105090699         CDS       T04642                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X2
  KO
K08734  DNA mismatch repair protein MLH1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01524  Platinum drug resistance
cdk03430  Mismatch repair
cdk03460  Fanconi anemia pathway
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    105090699 (MLH1)
   03460 Fanconi anemia pathway
    105090699 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090699 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105090699 (MLH1)
   05226 Gastric cancer
    105090699 (MLH1)
   05213 Endometrial cancer
    105090699 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105090699 (MLH1)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     105090699 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 105090699
NCBI-ProteinID: XP_010980340
LinkDB
Position
17
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVTITTKTT
DGKCAYRAQYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYAIHNSGISFSVKKQGETATDVRTLPGATTVDNIRSIFGNAVSRELIEVRCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESPSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVEHQLLGSNASRTYFTQTLLPGLAGPSGEVV
KSTAGVTSSAASGSGDKVYAYQMVRTDSREQKLDAFLQPVSRALSSQPQADVPEDRTDAS
SSGARQQDEEMPELPAPAEAAASHQGLEGDATKKASEPSEKRGPPSSPENPRKRHREGSD
METVDDASQKEMTAACTPRRRIINLTSVLSLQEEINQQGHEALREMLRDHSFVGCVNPQW
ALAQHQTKLYLLNTTRLSEELFYQILIYDFANFGVLRFSEPASLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFVL
RLATEVNWDEEKECFESLSKECALFYSIRKQYVSEESTLSSQQSEVPGSTPNPWKWTVEH
VVYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgcttgtagcgggagttatccggcggctggacgagacagtggtgaaccgaatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggaaatgattgaaaactgttta
gatgcaaaatccacaaatattcaagtggttgttaaagagggaggcctgaagttgattcag
atccaagacaatggcactgggatcaggaaagaagatctggatattgtgtgtgagcggttc
accacaagtaaactgcagtcctttgaggatttagctcacatctctacctatggctttcgg
ggcgaggctttggccagcataagccatgtggctcacgtcaccattacaaccaaaacaacc
gatgggaagtgcgcatacagagcacaatactcagatggaaagctgaaagcacctcccaaa
ccatgtgcaggcaatcaagggacccagatcacggtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatggaaaaattttggaagttgtt
ggcaggtatgcaatacacaattcaggcattagtttctcagtgaaaaaacaaggtgagacg
gcgactgacgtcagaacactgcccggtgccacgaccgtggacaacattcgctccatcttt
ggaaatgctgttagccgagaattgatagaagtgagatgtgaggataaaaccctcgccttc
aaaatgaatggctacatatccaacgcaaactactcagtgaagaagtgtatcttcttactg
ttcatcaaccatcgtctggtagagtcaccttccttaagaaaagccatagaaacagtgtat
gctgcatatttgcccaaaaacacgcacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtagacgtcaacgtgcatccgacgaagcacgaagttcacttcctgcacgaagac
agcatcctggagcgtgtgcagcagcacgttgagcaccagctcctgggctccaacgcctcc
aggacgtacttcacccagactttactaccaggtcttgctggcccctctggggaggtggtt
aaatctacagcgggtgtgacctcctcagctgcttctggaagtggcgacaaggtctacgcc
taccagatggtccgcacagattcccgggagcagaagctcgatgccttcctgcagcctgtg
agcagggccctgtccagtcagccccaggctgatgtcccagaggacaggacagatgcttct
agtagcggggccaggcagcaggatgaggaaatgcctgaactcccagctcctgctgaagca
gctgccagtcatcagggcctggagggggatgcaacaaagaaggcttcagagccatcagag
aagagagggccaccttccagcccggagaaccccagaaagcgacatcgggaaggctctgac
atggaaacggtggatgatgcatcccaaaaggaaatgaccgcagcttgtaccccccggagg
aggatcattaacctcaccagcgttctgagtctccaggaagaaattaaccagcagggacat
gaggctctccgggagatgctgcgtgaccactcctttgtgggctgtgtgaatcctcagtgg
gccttggcacaacatcagaccaagttataccttctcaacaccacgagacttagtgaagaa
ctgttctaccagattctcatttatgattttgccaattttggtgttctgaggttctcggag
ccagcatcgctctttgacctcgccatgctcgccttagacagtcccgagagcggctggaca
gaggaagatggtcccaaagaaggacttgccgaatacattgttgagtttctgaagaagaag
gccgagatgcttgcggactacttctctctggagattgatgaagaagggaacctgattgga
ttaccccttctgatcgacaactatgtgccccctttggagggtctgcctatcttcgttctc
cgactggccaccgaggtgaattgggatgaagaaaaggaatgttttgaaagcctcagtaaa
gaatgtgctctgttttactccatccggaagcagtacgtatccgaggagtcgaccctctcg
agccagcagagcgaagtgcctggctccactccaaacccctggaagtggactgtggagcac
gttgtctataaagccttccgctcacaccttctgcctccgaaacatttcacagaggatgga
aatatcttgcagcttgctaacctgcccgatctatacaaagtcttcgagaggtgttaa

DBGET integrated database retrieval system