KEGG   Camelus dromedarius (Arabian camel): 105092933Help
Entry
105092933         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 4A6
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00590  Arachidonic acid metabolism
cdk00830  Retinol metabolism
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105092933
   00590 Arachidonic acid metabolism
    105092933
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    105092933
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105092933
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105092933
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105092933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105092933
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     105092933
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP4 family
   105092933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 105092933
NCBI-ProteinID: XP_010983013
LinkDB All DBs
Position
13
AA seq 510 aa AA seqDB search
MSVSVLSPTRDLGGISGLLQVASLLSLLLLLLKAAQLYMHRQWLLRAFQQFPSPPSHWLY
GHYWEFQNGIELQPLLKRVEKYTSACPRWLWGTKAHVLVYDPDYIRVVLGRSDPKNPSSY
RLLAPWIGYGLLLLNGQTWFQHRRLLTPAFHYDILKPYVGLMANSVRVMLDKWEELVSQD
SQLEIFEHVSLMTLDTVMKCAFSHQGSNQTDRNSQSYIQAVGDLNNLFFSRLRNFFHQSD
IIYRLTPEGRRSHQLCQLAHQHTDKVIKLRKAHLQEEGEMEKLSQKRHLDLLDILLFARR
KNGSSLSDTDLRAEVDTFMFEGHDTTASGISWILYALASHPEHQQRCREEIQSLLGDGAS
ITWDHLDQMPYTTMCIKEVLRLYPPVPAISRELSKPITFPDGRSLPAGITVLLSFYALHH
NPKVWPNPEVFDPSRFAPASAQHSHAFLPFSGGSRNCIGKQFAMNEMKVAVALTLLRFEL
APDPSRVPIPTPRIVLKSKNGIHLHLRKLP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccccaccagagacctgggtggcatctctgggctcctgcag
gtggcctccctgctcagcctgcttctgcttctgctcaaggcagcacagctctacatgcac
aggcagtggctgctcagagccttccagcagttcccgtcccctccttcccactggctctac
ggacactactgggagttccagaatggcatagagctgcaaccgctactaaaaagggtagag
aaatacacaagcgcctgtcctcgctggctgtgggggacaaaagcccatgtgttggtctac
gacccggactacataagggtggtcctcgggagatcagatccaaagaaccctagttcctac
agattattggctccctggattgggtacggtttgctcctgttgaatgggcagacatggttc
cagcaccgacggctactgactcctgccttccactatgacatcctgaagccctatgtgggt
ctcatggcaaactctgtccgagtgatgctggacaagtgggaggagctcgtcagccaggac
tcgcagctggagatctttgaacacgtctccttgatgaccctggacaccgtcatgaagtgc
gccttcagccaccagggcagcaaccagacagacaggaactctcagtcctacatccaggcc
gtcggggacctcaacaatctgtttttttcccgcctgagaaatttcttccaccagagtgac
attatctacaggctgacccctgaaggccgcaggagccaccagctctgccagctcgcccac
caacacacagataaagtgatcaagctgaggaaggctcacctgcaggaggagggagagatg
gagaagttgagccagaagaggcacttggatctcctggacatcctcctctttgccagaagg
aagaatgggagcagcttgtctgacacagacctccgtgccgaagtggacacgttcatgttc
gagggtcacgacaccacagccagtggcatctcctggatcctctatgcactggcctcccac
cctgagcatcagcagaggtgccgggaagagatccagagcctcctgggggatggcgcctcc
atcacctgggaccacctggaccagatgccctacaccaccatgtgcatcaaggaggtactg
cgactctacccaccagtaccagccatcagcagggagctcagcaagcccataaccttccct
gacggacgctccttacctgcaggaatcactgtattgctctccttttatgcccttcaccac
aacccgaaggtgtggccgaacccagaggtgtttgacccatcccgctttgcaccagcttct
gctcaacacagccatgctttcctgcccttctcagggggatccaggaactgcatcgggaag
caatttgccatgaatgagatgaaggtggccgtggctctgaccctgctccgcttcgagctg
gcaccggatccctccagggtccctattcccactcccagaattgtgttgaagtccaagaac
gggatccacctgcatcttcggaagctcccctaa

DBGET integrated database retrieval system