KEGG   Camelus dromedarius (Arabian camel): 105093274Help
Entry
105093274         CDS       T04642                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04144  Endocytosis
cdk04218  Cellular senescence
cdk04350  TGF-beta signaling pathway
cdk04371  Apelin signaling pathway
cdk04390  Hippo signaling pathway
cdk04520  Adherens junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04659  Th17 cell differentiation
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05161  Hepatitis B
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05220  Chronic myeloid leukemia
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    105093274 (SMAD3)
   04390 Hippo signaling pathway
    105093274 (SMAD3)
   04371 Apelin signaling pathway
    105093274 (SMAD3)
   04068 FoxO signaling pathway
    105093274 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105093274 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    105093274 (SMAD3)
   04218 Cellular senescence
    105093274 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105093274 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105093274 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    105093274 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093274 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105093274 (SMAD3)
   05212 Pancreatic cancer
    105093274 (SMAD3)
   05225 Hepatocellular carcinoma
    105093274 (SMAD3)
   05226 Gastric cancer
    105093274 (SMAD3)
   05220 Chronic myeloid leukemia
    105093274 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    105093274 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105093274 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105093274 (SMAD3)
   05161 Hepatitis B
    105093274 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 105093274
NCBI-ProteinID: XP_010983423
LinkDB All DBs
Position
6
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggacggccggctgcaggtgtcccaccga
aaggggctcccccatgtcatctactgccgcctgtggcgatggcccgacctgcacagtcac
cacgagctgcgggccatggagctgtgtgagtttgcctttaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtggagaccccagttctacctcccgtgttggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cctgaaaacactaacttccccgcgggcatcgagccccagagcaatattccagaaacccca
cccccgggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gatgcaggttctccaaacctctccccgaatccgatgtccccggcacacaataacttggac
ctgcagcccgtgacctactgcgagccggccttctggtgctccatctcctactatgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccgtccatgacggtggacggcttc
accgacccctcgaactcggagcgcttctgcctggggctgctctccaacgtcaacaggaac
gcggcggtggagctgacgcggagacacatcgggcgaggtgtgcgactgtactacatcgga
ggggaggtcttcgcagagtgccttagcgacagtgccatctttgtccagtctcccaactgt
aaccagcgctacggctggcatccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaagagtttgccgccctcctggctcagtccgtcaaccagggcttc
gaggccgtgtaccagctgacgcgcatgtgcactatccgcatgagcttcgtcaagggctgg
ggcgccgagtacaggagacagacggtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctctgcagtggctggacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system