KEGG   Camelus dromedarius (Arabian camel): 105095381
Entry
105095381         CDS       T04642                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X4
  KO
K02085  adenomatosis polyposis coli protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04810  Regulation of actin cytoskeleton
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105095381 (APC)
   04390 Hippo signaling pathway
    105095381 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105095381 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105095381 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105095381 (APC)
   05206 MicroRNAs in cancer
    105095381 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105095381 (APC)
   05225 Hepatocellular carcinoma
    105095381 (APC)
   05226 Gastric cancer
    105095381 (APC)
   05217 Basal cell carcinoma
    105095381 (APC)
   05213 Endometrial cancer
    105095381 (APC)
   05224 Breast cancer
    105095381 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105095381 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    105095381 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105095381 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105095381 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105095381 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105095381 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cdk04812]
    105095381 (APC)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105095381 (APC)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    105095381 (APC)
Cytoskeleton proteins [BR:cdk04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     105095381 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 105095381
NCBI-ProteinID: XP_010985813
LinkDB
Position
3
AA seq 2845 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSFGSREGSVSSRSGECSPVPMGSFSR
RGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSHEAERQNEGQGVAEINMASSGSGQGSTARIDYETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNAGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGIGLGSYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCGTDERNALRRSSTAHAHANTYNFTKSENSNRTCPMPYAKVEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQNEQRQSRSQSTTYPVYPE
STDDKHLKFQPHYGQQECVSPYRSRAANGSETNRVGSNHGINQNVNQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDIPSSQKPAFSFSKN
SSGQSTKTEHISSSSENTSTPSSNAKRQNQLHPSSAQSRSGQTQKATSSSCKVPSINQET
IQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQETDSANTLQIAEIKENSGTRSAED
SVSEVPTASQHIRTKSSRLQASGLSSESTRHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQ
ETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKT
PPPPPPPTVQTKQEVPKNKAPSTEKREGGPKQAAVNAAVQRVQVLPDADTLLHFATESTP
DGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETENEQPEESNENQEKEAEKPT
DSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKL
LPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRA
GAQSGEFEKRDTIPTEGRSTDEAQRGKASSVAVPELDDNKTEEGDILAECINSAMPKGKS
HKPFRVKKIMDQVQQASVSSSGTNKNQLDGKKKKPTSPVKPMPQNTEYRTRVRKSTDSKN
NLNAERTFSDNKDSKKQNSKNNSKDFNDKLPNNEDRVRGSFTFDSPHHYTPIEGTPYCFS
RNDSLSSLDFDDDDVDLSREKAELRKGKENKESEAKVTSHTELTSNQQSASKTQAVTKHP
INRGQSKPVLQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQ
ENNNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSED
DLLQECISSAMPKKKKPSRLKGDNEKQSPRNVGGILAENLTLDLKDIQRPDSEHGLSPDS
ENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEE
KPFTSNKGPRILKPGEKSTLETKKIESENKGIKGGKKVYKSLITGKVRSNSEVSSQMKQP
LQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPSLKTPASKSPSEGQAATTSPRGAKP
SVKSELSPVTRQTSQTAGSNKGPSRSGSRDSTPSRPNQQPLSRPMQSPGRNSISPGRNGI
SPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQTNLTKQTGLSKNGSSIPRSES
ASKGLNQMSSSNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKL
EESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIE
YNDGRPVKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSA
SSESSEKAKSEDEKHVNSISGTKQTKESQVSTKGTWRKIKESEIPPTSSSQTTSSGAANG
AESKALIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTVLEKGNPNAKDS
KDNQGKQNVSNGSAPARTVGLENRLNSFIQVDAPDQKGTETKLGQSNVPASETNESSLTE
RTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDS
KADNTESSGTQSPKRHSGSYLVTSV
NT seq 8538 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagcgatg
gcttcttctggacagattgatttattagagcgtctcaaagaacttaacttagatagcagt
aacttccctggagtgaaactgcggtcaaaaatgtccctccgttcttttggaagccgagaa
ggatctgtatctagtcgttcaggagagtgcagtcctgttcctatgggttcattttcaaga
agagggtttgtaaatggaagcagagaaaataccggttatttagaagaacttgaaaaagag
agatcattacttcttgctgaccttgacaaagaagaaaaggaaaaagactggtattacgct
caactgcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
caaacggatatgaccagaaggcaattggaatatgaagcaaggcaaatcagagttgcaatg
gaagaacaattaggtacttgccaggatatggaaaaacgagcccagcgaagaataaccaga
attcaacaaatagagaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaagctggctcacatgaagctgagcggcag
aatgaaggtcaaggagtggcagaaatcaacatggcatcttcgggtagcgggcagggttca
actgcacgaatagattacgaaacagccagtgttttgagttctagtagcacgcactctgct
cctcgaagactgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcaaatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaacttgggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttactaatgaccactacagtattactttaagacggtat
gcaggaatggctttgacaaacttgacctttggagatgtagccaacaaggctacgctatgc
tctatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaggactta
cagcaggttattgcaagtgttttgaggaatttgtcttggagagcagatgtaaatagtaaa
aagacattgcgtgaagttggaagtgtgaaagcattgatggaatgtgctttggaagtgaaa
aaggaatcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgccgtagatggcgcacttgcatttttggttggcactctc
acttaccggagccagacaaataccttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaagaccacaggcaaatcctaagagagaacaat
tgcttacaaaccttattacaacatttgaaatctcacagcctgacaatagtcagtaatgca
tgtggaaccttgtggaatctctcagcaagaaatcctaaagaccaggaagcgttatgggac
atgggggcagtcagcatgctcaagaacctcattcattccaagcacaaaatgattgctatg
ggaagcgccgcagctttaaggaatctcatggcaaacaggcctgcaaagtataaggatgcc
aatatcatgtctcctggctcaagcttgccttctcttcatgtcaggaaacaaaaagcccta
gaagcagaattagatgctcagcacttatcagaaacctttgacaatattgacaatttaagt
cccaaggcatctcatcgtagtaaacaaagacacaagcagagtctctatggggactacgtt
tttgacaccaatcgacatgatgataataggtcagacaactttaatgctgggaacatgact
gtcctgtcaccatacttaaataccacagtgttgcccagctcctcttcatcaaggggaagt
ttagatagttctcgttctgagaaagatagaagtttggagagagaacgaggtattggcctc
ggcagctaccacccagcaacagaaaatccaggaacctcgtcaaagcgaggtttgcagatt
tccaccactgcagctcagattgccaaagtcatggaagaagtatcagccattcatacctcc
caggaagacagaagttctgggtctaccaccgaattacactgtgggacagatgagaggaat
gcactgagaagaagctctactgcccacgcacatgcaaacacttacaacttcaccaagtca
gaaaattcaaacaggacatgtccaatgccgtatgccaaagtagaatataagaggtcttca
aatgacagtttaaatagtgtcagtagtagtgatggttatggtaaacgaggtcagatgaaa
ccttcaattgaatcctattctgaagatgatgaaagtaagttttgcagctatggtcaatat
ccagctgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattatagtcttaagtattcagatgaacagttgaactctggaagg
caaagtccctcacagaatgaaagatgggcaagacccaaacatataatagaagatgaaata
aagcaaaatgagcaaagacaatcaaggagtcaaagcacaacttatcctgtatatcctgag
agcactgatgataaacacctcaagttccagccacattatggacagcaagaatgtgtttcc
ccatatcggtccagagcagccaatggttcagaaacaaatcgagtaggttccaatcatgga
attaatcaaaatgtcaaccagtctttgtgccaggaagatgactatgaagatgataagcca
accaactatagtgaacgttactctgaggaagagcagcatgaggaggaggagagaccaacc
aattacagcatcaaatataatgaagaaaaacatcacgtggatcaacctattgattatagt
ttaaaatatgccacagacattccttcttcacagaaaccagcattttcattctcaaagaat
tcatctggacagagcaccaagactgaacacatctcttcgagcagtgagaatacatccaca
ccttcatctaacgccaagaggcagaaccagctccatccaagttcagcccagagcagaagt
ggtcagacccaaaaagccacctcctcctcttgcaaagttccctctatcaaccaagaaaca
atacagacgtactgtgttgaagataccccaatttgtttttcacgatgtagttcattatca
tctttgtcatcagctgaagatgaaatcgggtgtgatcagacaacacaggaaacagattct
gctaatactctacaaatagcagaaataaaggaaaacagtggaactagatcagctgaagat
tctgtgagtgaagttccaacagcgtcacagcacattagaaccaaatccagcagactccag
gcttctggtttatcttcagaatcaaccaggcacaaagctgttgaattttcttcaggggcc
aaatctccatcaaagagtggtgctcagacacctaaaagtccaccggagcactacgttcag
gagactccactcatgtttagcagatgtacgtctgtcagttcacttgatagttttgagagc
cgttcgattgccagctctgttcagagtgaaccctgcagtggaatggtgagtggcattata
agccccagtgaccttccagatagccctggacaaaccatgccacccagcagaagtaaaacc
cctcctccccctccccctccaacagttcaaactaagcaagaagtacctaaaaataaggca
cctagcactgaaaagagagaaggtggacctaagcaagccgctgtaaatgctgcagtgcag
cgggtccaggttcttccagatgctgatactttgttacattttgcaacagaaagtactcca
gatggattttcttgttcatctagcctgagtgctctgagcctcgatgagccattcattcag
aaagatgtggaattaagaatcatgcctccagttcaggaaaatgacaatgggaatgaaaca
gaaaacgagcagcctgaagaatcaaatgaaaaccaggaaaaagaggcagaaaaacccact
gattctgaaaaagatctattagatgattcagatgacgatgatattgaaatactagaagag
tgcattatttctgccatgccgacaaaatcttcacgcaaagccaaaaagccagcccagact
gcttcaaaattacctcccccagtggcacggaaaccaagtcagctgcctgtgtacaaactt
ctgccatcacagaacaggttacaagcacaaaagcatgttagctttacaccaggagatgat
atgccacgggtgtactgtgtagaagggacaccgataaacttctccacagctacatctctg
agtgatctaacaatagaatcccctccaaatgagttagctgctggagaaggggttagagca
ggggcacagtcgggtgaatttgaaaaacgagataccattcctacagaaggcagaagtaca
gatgaggctcagagagggaaagcctcatctgtagctgtacctgaactggatgataataaa
acagaagaaggtgacattcttgcagaatgcattaattctgctatgcccaaggggaaaagt
cacaagcctttccgtgtgaaaaaaataatggaccaggtccaacaagcatctgtgtcttca
tccggaactaacaaaaatcaattagatggtaagaaaaagaaacctacttcaccagtaaaa
cctatgccacaaaatactgaatacaggacacgtgtaaggaaaagtacagactcaaaaaat
aatttaaatgctgaaagaactttctcagacaacaaagattcaaagaaacagaactcgaaa
aataattccaaggacttcaatgataagctaccaaataatgaagatagagtcagaggaagt
tttacttttgattcaccacatcattacacacctattgaaggcactccgtactgtttttca
cgaaatgattccttgagttctctagattttgatgatgatgatgttgacctttccagggaa
aaggctgaattaagaaaagggaaagaaaataaggaatcagaagctaaagttaccagccac
acagaactaacctcaaaccaacagtcagctagtaagacacaagctgttacaaaacatcca
ataaatcgaggtcagtctaaacctgtcctgcagaagcaatctacgtttccccagtcctcc
aaagatataccagacagaggggcagcaactgatgagaaactacagaattttgctattgaa
aatactccagtttgcttttctcgaaattcctctctgagttctctgagtgacattgatcaa
gaaaacaacaacaacaaggaaaatgaacctatcaaagagacagagccccctgactcacag
ggagaaccaagtaaaccccaggcatcaggttatgctccaaaatcatttcacgtcgaagat
acccctgtttgtttctcaagaaacagttctctcagttctctgagtattgattctgaagat
gacctgttgcaggaatgtataagttctgcaatgccaaaaaagaaaaagccttcaagactc
aaaggtgataatgaaaagcagagtcccagaaatgtgggtggcatattagcagaaaatttg
acacttgatttgaaagatatacagagaccagattcagaacatggtttatcccctgattca
gaaaattttgattggaaagctattcaggaaggtgcaaattccatagtaagcagtttacat
caagctgctgccgctgcgtgtttatccagacaagcttcgtctgattcagattccatcctt
tcactgaaatcaggaatctctctgggatcaccatttcatcttacacctgatcaagaagaa
aaaccctttacaagtaataaaggcccacgaattctaaaacctggggagaaaagtacattg
gaaactaaaaagatcgaatctgaaaataaagggataaaaggagggaaaaaagtttataaa
agtttgattactggcaaagttcgatctaattcagaagtttcaagccaaatgaagcagccc
cttcaaacaaacatgccttcaatctctcgaggtaggacaatgattcatattccaggagtc
cggaatagctcttcaagtacgagtccagtttccaaaaaaggcccatcccttaagactcca
gcctccaaaagccctagtgaaggtcaggcggctaccacttctcccagaggagccaagcca
tcagtcaagtcagaattaagccctgttaccaggcagacgtcccaaacagctgggtcaaat
aaagggccttctcgatcaggatccagagattccactccttccagacccaaccagcagccg
ctaagcagacctatgcagtctccagggcgaaactcaatttctcctggtagaaatggaata
agtccccctaacaagttatctcagctgccacggacgtcatccccaagcactgcttcaact
aagtcctcgggttctgggaaaatgtcttacacatccccaggcagacagatgagccagaca
aaccttactaaacaaacgggtttatccaagaatggtagtagtatcccaagaagtgagtct
gcctccaaagggctaaatcaaatgagtagcagcaacggatccaataaaaaggtagaactt
tccagaatgtcttcaactaaatcaagtggaagtgagtctgataggtcagagagacctgta
ttagtacgccagtcaactttcatcaaagaagcgccaagcccgaccttaaggagaaaattg
gaggaatctgcttcatttgaatccctttctccatcttctagaccagattctcccactagg
tcccaggcacagactccagttttaagtccttctcttcctgatatgtctttgtctacacac
tcatctgttcaggctggtgggtggcgaaaactcccacctaatctcagccccaccatagag
tataatgacgggagacctgtaaagcgccatgacatagcccgctcccattctgaaagtcct
tccagacttcccattaacaggtcaggaacctggaaacgtgagcacagcaaacactcatcc
tcccttcctcgagtaagcacttggagaagaactggaagttcatcctcaattctttctgct
tcatcagaatccagtgaaaaagcaaaaagtgaagatgaaaaacatgtgaactcgatttca
ggaaccaaacaaactaaagaaagccaagtatccactaaaggaacatggagaaaaataaaa
gaaagtgaaattcctcccacaagcagttctcagaccacttcctcaggtgctgcaaatggt
gctgaatcaaaggctctcatttatcaaatggcgcctgctgtttctaagacagaggatgtt
tgggtgagaattgaggactgtcccattaacaaccctagatctggaagatctccaacggga
aatactcccccagtgattgatactgttttggaaaagggaaacccaaacgctaaagattca
aaagataatcagggaaaacaaaatgtgagtaacggtagtgctcccgcgcgcaccgtgggt
ttggaaaaccgcctgaactcctttattcaggtagatgccccagaccaaaaaggaactgag
acgaaattgggacaaagtaatgtccctgcatcagagaccaatgaaagttctctcactgag
cgcaccccgtttagttctagcagctcaagcaagcacagttcgccaagtgggactgttgct
gccagagtgactccttttaattacaacccaagccctaggaaaagcagcgcagatagcact
tcagcccgaccatctcagatcccgacgccagtgaataacaacacaaagaaacgagattca
aaagctgacaacacagaatccagtggaactcaaagtcccaaacgccattccgggtcttac
cttgtgacgtccgtttaa

KEGG   Camelus dromedarius (Arabian camel): 105104128
Entry
105104128         CDS       T04642                                 

Gene name
APC2
Definition
(RefSeq) LOW QUALITY PROTEIN: adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04810  Regulation of actin cytoskeleton
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105104128 (APC2)
   04390 Hippo signaling pathway
    105104128 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105104128 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105104128 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105104128 (APC2)
   05206 MicroRNAs in cancer
    105104128 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105104128 (APC2)
   05225 Hepatocellular carcinoma
    105104128 (APC2)
   05226 Gastric cancer
    105104128 (APC2)
   05217 Basal cell carcinoma
    105104128 (APC2)
   05213 Endometrial cancer
    105104128 (APC2)
   05224 Breast cancer
    105104128 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105104128 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    105104128 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105104128 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105104128 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105104128 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105104128 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cdk04812]
    105104128 (APC2)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105104128 (APC2)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    105104128 (APC2)
Cytoskeleton proteins [BR:cdk04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     105104128 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Suppressor_APC Arm Arm_APC_u3 SAMP bZIP_1 IL4 Sec2p HALZ Wtap Herpes_BLRF2
Other DBs
NCBI-GeneID: 105104128
NCBI-ProteinID: XP_031294067
LinkDB
Position
22
AA seq 2257 aa
MGLLGLLSLLHSAFFGDQALQELKMTSSVAPYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPAL
APEPAAQTPEESPVHSSGPSKDSFGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDKELLSAQDRVQQTEPQALLAVKSVPMDEDPETEVPTHPEDGAPQPGNSKVEVV
FWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTGTEAGAGGRHGN
PGAPGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGG
PEGSGAPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTQDP
LNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASESEELHQVVSSILRNLS
WRADINSKKVLREVGSMTALTQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGA
LGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSH
SLTIVSNACGTLWNLSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAH
RPAKYQAAATAVSPGACAPSLYVRKQRALEAELDARHLAQALDHLEKQGPPEAEAEASSK
KPLAALRHLDGLAQDYASDSGCFDDDDAXALLATAAAALVCFAGHTGATAPRPATQTEGT
ASAGCLSLFLGPHSPFLHTAQALARAPAARRGGPGRDKAYQAGVWNSPGQYPPPRQCVVE
AISVLSTPVCITPHRLVSLCVHVISNDSLNSGSTSDGHSRPSQLAALVEHREGPLCSQER
PSRLDLHLPGSQAEPAARHSVATDAQVRTIKLSPTYQHVPLLEGTAPLASGARKQAWLPT
EGLSKVPEKLVAEATPLCLSRCSSLSSLSSAGHPGHSEAGDLDDSDSSLEGLEEAGPRKA
ELDGVWRGPGTASLPMAIPVPRQGRGLGVEDATPSSSSENCVQETPLVLSRCSSVSSLGS
FESPSIASSIPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPLALAPPGEREATQFS
LQWESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHELYVQK
DVELRLLPPAGPERGRGGSGGPGPHLTGHRRLDEAGVRLEGPTSTDQELERLRDCLGAAV
PARLRKVASALVPGRRALPVPVYMLVPAPAREDDSCTDSAEGTPVNFSSAASLSDETLQG
PHRDGGRADGQKPAGRTTPTKQPAGHQHRAGGMGRKTEQPRGAGRSRAGLELPLRRPPSA
CGDRESSRPGRARGDEALQSLCLTTPTEEAVYCFCGNDSDEEPPTAVAVAPPRRVSAIPR
AVKRERLAGGRKEAQVAPKAMPTAAPPTRAQPSLIADETPPCYSLSSSASSLSEPEPSGR
TAGRPRAPEPAATKGGQDSSPSPRAEAELLRRCIGSAMPRRRPQAPGPRRRQPRAARPEE
QPAEVHQEHSEEAAGSDHASDLDSVEWRAIQEGANSIVTWLHQAAAAATREASSESDSIL
SFTSGLSVGSTLQPTLHGQGRRPRAEGQASSAVRPEKQDVALAQRSGGPEKPRGAQKTAS
RVPAVLRGRTVIYVPSPAARAQPKGAPGPRTVPRKMGAPSPVQPAAPAKALGTGQQRSRS
LHRPGKTSELAALRPPQRSATPPARLAKTPSSSSSQTSPASQPLPRRSLPATQAGGPLPG
PGAAPVPKTPARALLAKQHKTQKSPVRIPFMQRPAGRGPPPLARAAPEPGPRGRAGAEVG
PGTRGGRLGLVRVASARSSGSESSDRSGFRRQLTFIKESPGLLRRRRSELSSAEATTPAA
QAGSPPPGLPALPAVFLCSSRCDELRAPPQQAPAPQQLPAARASPCERPPRRTSSESPSR
LPVRTPAARPETVKRYASLPHISTAPRPNSAAPRPAADPSRRGSDGEARPLPRVAAPGTT
WRRIRDEDVPHILRSTLPATALPLMGSSPEEGPAGPPQRKTSDAVVQTEDFAATKTNSST
SPSLESREPPQTIAGGPTSLLGSDVDGPSPAKAPTPTPFVHEGLGVAAGGFPTSRHGSPS
RSARVPPFNYVPSPMVAATADSAVEKAPVPIPTSLLE
NT seq 6774 nt   +upstreamnt  +downstreamnt
atggggctcctggggctgctgagcctgctgcactcggctttcttcggggaccaggcactg
caggagctgaagatgacgagctccgtggcaccctatgagcagctggtgcgacaggtggag
gccttgaaggccgagaacagtcacctgcggcaggagcttcgggataactcaagccacctg
tccaagctggagacagagacatcaggcatgaaggaggtcctgaagcacttacagggcaag
ctggagcaggaggcccgagtgctggtgtcctcggggcagactgaggtgctggagcagctg
aaagccctgcagatggacatcaccagcctgtacaacctcaagttccagcccccggctctg
gccccagagccagctgcccagacccctgaggaaagcccagtacacagctccgggccctcc
aaggacagctttggggagctgagccgggccaccatccggctgctggaggaactggacagg
gaaaggtgtttcctgttgaacgagattgagaaggaggaaaaggagaagctctggtattac
tcgcagctgcagggcctgtccaagcgcctggacgagctcccgcacgtggagacgcagttc
tcgatgcagatggacctgatccgtcaacagctggagttcgaggcgcagcacatccgctcg
ctgatggaggagcgcttcggcacctcggacgagatggtgcagcgggcgcagatccgtgct
tcccgcctggagcagatcgacaaggaactgctgtcagctcaggacagagtgcagcagacg
gagccccaggccttactggcagtgaagtcagtgccaatggacgaggaccctgagacggag
gtccccacgcaccctgaggatggtgcccctcagccaggcaacagcaaggtggaggtggtc
ttttggcttctgtccatgctggcgacgcgtgaccaggaggacacagcccgcacgctgctc
gccatgtccagctcacccgagagttgtgtggccatgcgccgctcgggctgcctaccgctg
ctgctgcagatcctgcacggcaccggcaccgaggcgggggctgggggccgccacgggaac
cctggggcgccgggagccaaggacgcacgtatgcgcgccaacgcagcgctgcacaacatc
gtcttctcccagccggaccagggcctggcgcgcaaggaaatgcgtgtcctgcacgtgctg
gagcagatccgcgcctactgtgagacctgctgggactggctgcaggcccgggacggcggg
cccgagggaagcggcgccccggtccccatcgagccacagatctgccaggccacctgtgct
gtgatgaagctgtcgttcgacgaggagtaccgccgggccatgaacgagctgggtgggctg
caggccgtggcagagttactgcaggttgactacgagatgcacaagatgacccaggatcct
ctgaacctggccctgcgccgatatgctggcatgacactcaccaacctcaccttcggggat
gttgccaacaaggccacgctgtgcgcccgccggggctgcatggaggccatcgtggcccag
ctggcatctgagagcgaggagctccaccaggtggtgtccagcatcctgcggaacctgtcc
tggcgggctgacatcaacagcaagaaggtgctgagggaggtgggcagcatgactgccctg
acgcagtgcgtcctgcgagccaccaaggagtccaccctaaagagcgtgctcagcgccctg
tggaacctctcagcgcacagcacggagaacaaggccgccatctgccaggtggacggcgcc
ctgggcttcctggtgagcacactgacctacaagtgccagagcaactcgctggccatcatc
gagagcggcggcggcatcctgcgcaacgtgtccagcctcgtcgccacccgcgaggactac
aggcaggtgctgcgggaccacaactgcctgcagacgctgctgcagcacctgacatcgcac
agcctgaccatcgtgagcaacgcgtgtggcacgctgtggaacctgtcggcccgcagcccc
cgcgaccaggagctgctgtgggacctgggcgccgtgggcatgctgcgcaacctggtgcac
tccaagcacaagatgatcgccatgggcagcgctgccgccctgcgcaacctgctggcccac
cggccggccaagtaccaggcggccgccaccgccgtctcccccggcgcctgcgcgcccagc
ctgtacgtgcggaagcagcgcgcgctggaggccgagctggacgcgcggcacctggcccag
gcgcttgaccacctggagaaacagggcccacccgaggccgaggccgaggcctcttccaag
aagcccctggccgccctgcggcacctggatggcctggcccaggattacgcctctgactcg
ggctgcttcgacgacgacgacgcannagccctcctggccaccgccgccgccgccctggtc
tgtttcgccggccacaccggcgccaccgcaccacgccccgcaacacaaactgagggcact
gccagcgctggatgtctgtccctcttcctgggtccacacagccccttcctgcatacggcg
caggcgctggcccgcgcccccgccgcccgccgtggtggccctggcagagacaaggcttac
caagctggggtttggaattcccccggtcagtacccaccaccgcgtcaatgtgtggtggag
gccatctcggttttgtcaacacccgtttgtatcacgccacaccgccttgtgtcgctttgt
gtgcacgtcatctccaacgacagtcttaacagcggtagcactagcgacgggcactcgagg
cccagccagctggcggcgctggtggagcaccgagagggtcccttgtgtagccaggagcgg
ccgagccggcttgacctccacctgcccggcagccaggctgagccagcagcccggcacagc
gtggccaccgatgcccaagtgcgcaccatcaagctgtcacccacctaccaacacgtgcca
ctgcttgagggcactgcgcccctggcatctggggcccggaaacaggcctggctgcccaca
gagggcctgagcaaggtccccgagaagctggtggccgaggccacacctctctgcctgtcc
cgctgcagctccctgtcctcactgtcttcggccggccacccgggccacagtgaggctggg
gacctggacgacagtgattcgtccctggaggggctggaggaggctggccccagaaaggca
gagctggacggggtctggcgagggccggggactgcctcgctgcctatggccatcccggtg
ccccggcagggtcgtgggctgggggtggaggatgccacaccctcaagctcatctgagaac
tgtgtgcaggagacaccgctggtgctgagccgctgcagctccgtcagctctctgggcagc
tttgagagcccgtccatcgccagctccatccccagtgacccgtgcagtgggctgggcagt
ggcacggtcagccccagtgagctgcccgacagccccgggcagaccatgccgccaagccgc
agcaagacgccgccactggccctggcaccaccaggtgagcgggaggccacccagttcagc
ctgcagtgggagagctacgtgaagcgcttcctggacatcgccgactgccgggagcgctgc
cggctgccgtccgagctggacgcgggcagcgtgcgcttcacggtggagaagccggatgag
aacttctcctgcgcctccagcctcagtgcgctggccctgcatgagctctacgtgcagaag
gacgtggagctgcggctgctgcccccggccggccccgagcgcggccgcggcggaagcgga
ggcccaggcccccacctgactgggcatcgccggctggacgaggctggtgttcgcctcgag
gggccgacatccactgaccaggagctggagcggctgcgtgactgtcttggtgcagccgtg
cctgcccggctccgcaaggtggcctccgcattagtgcctggccgccgtgcactgcctgta
ccggtctacatgctggtgcctgccccggcccgggaggatgactcctgcactgactcggcc
gagggcacgccggtcaacttctccagtgccgcctcgctcagcgatgagacgctgcaggga
ccacacagggacggcgggcgtgcagatggccagaagcccgcaggccgcaccacccccaca
aagcagcctgcaggacaccagcacagggcaggaggtatgggccggaaaacagagcagccc
cgaggggctggcaggagccgggcggggctggagctgcccctccgcaggcccccgagcgcc
tgcggggacagggaaagctcgcgcccaggtcgggcacgtggggatgaggccctgcagtct
ctgtgcctcacgacacccaccgaggaggcggtgtactgcttctgtggcaacgactcggac
gaggagccacccacagcagtggcggtggcgcccccacggcgggtatccgccatcccccgg
gcggtgaagagggagcgcctggctggtggcaggaaggaggcacaggtcgcacccaaggcc
atgcccacggccgcgccgcccaccagggcccagcccagcctcattgctgacgagacgccc
ccatgctactccctgagctcctcggccagctccctcagtgagcctgagccctccgggcgc
acagccggccggccccgagcccctgagccagcggctaccaagggtgggcaggacagctcc
cccagcccgcgggccgaggcagagctgctgcggcgctgcatcggctcagccatgcccaga
cgccggccccaggcccccggcccgcggcgtcgccagccccgagctgcgcgaccagaggag
cagccggcagaggtgcaccaggagcatagcgaggaggcggcgggctcagaccatgcctca
gacctggacagcgtcgagtggcgagccatccaggagggcgccaattccatcgtcacgtgg
ctgcaccaggcggccgcggcagccacccgcgaagcctcgtccgaatctgactccatcctg
tccttcacgtcggggctatcagtgggctccaccctgcagcccaccttgcatgggcagggg
cgacgcccaagggcagaaggccaagcaagcagtgctgtgcggccagaaaaacaggacgtg
gccttggcccagcgcagcggtggcccggagaagccacgtggcgctcagaagactgcatcc
agggtgccagccgtgctcaggggacggacggttatctacgtgcccagcccagcagcccga
gctcagcccaaaggtgcccccggcccccgcactgtgccaagaaagatgggagccccaagc
cccgtgcagccagcagctccagccaaagccctcggcaccgggcagcagcggtctcggagc
ctgcaccggcctggcaagacctcggagctggcggcactgaggccccctcagaggagcgcc
acaccgcccgctcgcctggccaagaccccctcatcgagctcctctcagacctcccctgcc
tcccagcctctgcccaggaggtcgctcccagccacccaggctgggggacccctgcctggc
cctggggccgctccagtgcccaagacccccgcacgggccctgctggcaaagcagcacaag
acacagaagtcgccggtgaggatccccttcatgcagaggcctgccgggcgggggccgcca
cccctggccagggcggccccagaacccggtcccagaggccgggcaggggccgaggtgggc
ccaggcacccgagggggccgcctgggcctggtgcgcgtggcctccgcccgctccagcggc
agcgagtcctccgaccgctcgggcttccggcggcagctgaccttcatcaaggagtcacca
ggcctgctgcgccgacgccgctctgaactgtcctcggccgaggccaccacccctgctgcc
caggccggctcgcccccgcctggcctgcctgcgctgcctgccgtcttcctctgctcctcg
cgctgcgacgagctgcgggcgcccccccagcaggccccggccccacagcagctccccgca
gcccgggccagcccctgcgagaggccgccccggcgcaccagctccgagagcccatcgcgc
ctgcctgtccgcacaccagcggcccggcccgagacggtcaagcgctacgcttctcttccc
cacatcagcacggcccccaggcccaacagcgccgcccccaggcccgcggctgacccgtcc
cgccgcggcagtgacggggaggcccggccgctgcccagggtggctgcgccgggtaccacg
tggcgtcgcatccgggacgaagatgtcccgcacatcctgcggagcacgctgcctgccacc
gccctgcccctgatgggctcctcgcccgaggagggcccggctggcccaccgcagcgcaag
accagtgacgctgtggtccagacagaggacttcgctgccaccaagaccaactccagcaca
tctccaagcctggagagcagggagcctccccagaccatagccggcggccccacctccctc
cttggcagcgacgtggacgggcccagccctgccaaggcgcccacccctaccccctttgtc
cacgagggcctaggggtggctgcagggggctttcctaccagccggcatggctcccccagc
cgctcagcccgggttccccccttcaattatgtgcccagtcccatggtggcagccaccgct
gactctgccgtggagaaagcccctgtccccatccccaccagcctcctggaatag

DBGET integrated database retrieval system