KEGG   Camelus dromedarius (Arabian camel): 105102890
Entry
105102890         CDS       T04642                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04071  Sphingolipid signaling pathway
cdk04115  p53 signaling pathway
cdk04141  Protein processing in endoplasmic reticulum
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04215  Apoptosis - multiple species
cdk04217  Necroptosis
cdk04722  Neurotrophin signaling pathway
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05012  Parkinson disease
cdk05014  Amyotrophic lateral sclerosis
cdk05016  Huntington disease
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05132  Salmonella infection
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105102890 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    105102890 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105102890 (BAX)
   04215 Apoptosis - multiple species
    105102890 (BAX)
   04217 Necroptosis
    105102890 (BAX)
   04115 p53 signaling pathway
    105102890 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105102890 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    105102890 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102890 (BAX)
   05202 Transcriptional misregulation in cancer
    105102890 (BAX)
   05203 Viral carcinogenesis
    105102890 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105102890 (BAX)
   05212 Pancreatic cancer
    105102890 (BAX)
   05225 Hepatocellular carcinoma
    105102890 (BAX)
   05226 Gastric cancer
    105102890 (BAX)
   05214 Glioma
    105102890 (BAX)
   05216 Thyroid cancer
    105102890 (BAX)
   05220 Chronic myeloid leukemia
    105102890 (BAX)
   05217 Basal cell carcinoma
    105102890 (BAX)
   05218 Melanoma
    105102890 (BAX)
   05213 Endometrial cancer
    105102890 (BAX)
   05224 Breast cancer
    105102890 (BAX)
   05222 Small cell lung cancer
    105102890 (BAX)
   05223 Non-small cell lung cancer
    105102890 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    105102890 (BAX)
   05014 Amyotrophic lateral sclerosis
    105102890 (BAX)
   05016 Huntington disease
    105102890 (BAX)
   05020 Prion disease
    105102890 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    105102890 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    105102890 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105102890 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105102890 (BAX)
   05152 Tuberculosis
    105102890 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105102890 (BAX)
   05170 Human immunodeficiency virus 1 infection
    105102890 (BAX)
   05161 Hepatitis B
    105102890 (BAX)
   05160 Hepatitis C
    105102890 (BAX)
   05164 Influenza A
    105102890 (BAX)
   05162 Measles
    105102890 (BAX)
   05168 Herpes simplex virus 1 infection
    105102890 (BAX)
   05163 Human cytomegalovirus infection
    105102890 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105102890 (BAX)
   05169 Epstein-Barr virus infection
    105102890 (BAX)
   05165 Human papillomavirus infection
    105102890 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105102890 (BAX)
   01524 Platinum drug resistance
    105102890 (BAX)
   01522 Endocrine resistance
    105102890 (BAX)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    105102890 (BAX)
Transporters [BR:cdk02000]
 Other transporters
  Pores ion channels [TC:1]
   105102890 (BAX)
SSDB
Motif
Pfam: Bcl-2 TetR_C_30 CF222
Other DBs
NCBI-GeneID: 105102890
NCBI-ProteinID: XP_031314916
LinkDB
Position
9
AA seq 192 aa
MDGSGEQPRGVGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQIPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMRWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcgtggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacctgagctgggcctggagcagattccccaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggagatgaactcgacagtaacatggagttgcagaggatgatc
gcggctgtggacacagactccccccgagaggtctttttccgagtggcggccgaaatgttt
tctgacggcaacttcaactggggccgggttgtagcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgcctgaactgatcaggacaatcatgcgctggaca
ctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatcttcgtggccggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system