KEGG   Camelus dromedarius (Arabian camel): 105105749
Entry
105105749         CDS       T04642                                 

Gene name
EGFR
Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04144  Endocytosis
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk04912  GnRH signaling pathway
cdk04915  Estrogen signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105105749 (EGFR)
   04012 ErbB signaling pathway
    105105749 (EGFR)
   04014 Ras signaling pathway
    105105749 (EGFR)
   04015 Rap1 signaling pathway
    105105749 (EGFR)
   04630 JAK-STAT signaling pathway
    105105749 (EGFR)
   04066 HIF-1 signaling pathway
    105105749 (EGFR)
   04068 FoxO signaling pathway
    105105749 (EGFR)
   04020 Calcium signaling pathway
    105105749 (EGFR)
   04072 Phospholipase D signaling pathway
    105105749 (EGFR)
   04151 PI3K-Akt signaling pathway
    105105749 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105105749 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105105749 (EGFR)
   04520 Adherens junction
    105105749 (EGFR)
   04540 Gap junction
    105105749 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105105749 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105105749 (EGFR)
   04915 Estrogen signaling pathway
    105105749 (EGFR)
   04921 Oxytocin signaling pathway
    105105749 (EGFR)
   04926 Relaxin signaling pathway
    105105749 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    105105749 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105105749 (EGFR)
   05206 MicroRNAs in cancer
    105105749 (EGFR)
   05205 Proteoglycans in cancer
    105105749 (EGFR)
   05230 Central carbon metabolism in cancer
    105105749 (EGFR)
   05231 Choline metabolism in cancer
    105105749 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105105749 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105105749 (EGFR)
   05212 Pancreatic cancer
    105105749 (EGFR)
   05225 Hepatocellular carcinoma
    105105749 (EGFR)
   05226 Gastric cancer
    105105749 (EGFR)
   05214 Glioma
    105105749 (EGFR)
   05218 Melanoma
    105105749 (EGFR)
   05219 Bladder cancer
    105105749 (EGFR)
   05215 Prostate cancer
    105105749 (EGFR)
   05213 Endometrial cancer
    105105749 (EGFR)
   05224 Breast cancer
    105105749 (EGFR)
   05223 Non-small cell lung cancer
    105105749 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105105749 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    105105749 (EGFR)
   05171 Coronavirus disease - COVID-19
    105105749 (EGFR)
   05163 Human cytomegalovirus infection
    105105749 (EGFR)
   05165 Human papillomavirus infection
    105105749 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105105749 (EGFR)
   01522 Endocrine resistance
    105105749 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105105749 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105105749 (EGFR)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105105749 (EGFR)
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   105105749 (EGFR)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105105749 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   105105749 (EGFR)
  Exosomal proteins of bladder cancer cells
   105105749 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Kdo Borrelia_P83
Other DBs
NCBI-GeneID: 105105749
NCBI-ProteinID: XP_031300868
LinkDB
Position
36
AA seq 1150 aa
MFNNCEVVLGNLEITYMQNSYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLY
ENTHALAVLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPSLCSVETVQWRDIVNNEFL
SNMSMDFQNQPGGCPKCDPSCVNGTCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPNGKYSFGATCVK
NCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINA
TNIKHFRNCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVREITGFLLIQAWPEN
RTGLHAFENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNQNLCYAN
TINWKKLFGTSSQKTKIINNRSEQECKAVGHVCNPLCSSEGCWGADPKDCVSCRNVSRGK
ECVEKCNVLEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPSSCVKCAHYIDGPNCVK
TCPAGIAGENGTLVWKFADASHVCHLCHPNCTYGCAGPGLKGCAENRPKIPSIATGIVGG
LLMVVVLALGVGLFLRRRHIVRKRTLRRLLQAELVEPLTPSGEAPNQALLRILKETEFKK
VKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV
CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLV
HRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMID
ADSRPKFRELIIEFTKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD
EYLVPQQGFFHSPATSRTPLLSSLSATSNTPTVACVDRNGQSYPLKEDSFLQRYSSDPTG
TLTEDSLDDTFLPAPEYVNQFIPKRPAGSVQNPVYHNQPLHPAPGRDPHYQNSHSNAVDN
PEYLNTAHPACVNGALSGPALWAQKGTPQISLDNPDYQQAFXANAILEGPAAGDAKYLRA
APASRDLTGA
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgtttaataactgcgaggtggtcctagggaacttggaaatcacctacatgcagaatagt
tacgacctgtctttcctcaagaccatccaggaggtggccggctacgtactcattgccctc
aacaccgtggagaagattcctctggaaaacctgcagatcatcaggggcaacgtgctctat
gaaaacacccatgccttggcggtcctgtccaactacggggcgaataaaaccggactgcgg
gagctgcccatgagaaacctgcaggagatcctgcaaggtgccgtgcgcttcagcaacaac
cccagcttgtgcagcgtggagaccgtccagtggagagacatcgtcaacaacgaattcctc
agcaatatgtcgatggactttcagaaccagccgggcggttgcccaaagtgtgatccaagc
tgtgtcaacggaacctgctggggcgcagggaaagagaactgccagaaattgaccaaagtc
atctgtgcccagcagtgctccgggcgctgccgcgggaggtcccccagtgactgctgtcac
aaccagtgtgccgccggctgcacggggccgcgggagagcgactgcctggtctgccgcaag
ttccgggacgaagccacgtgcaaggacacgtgcccgccgctcatgctctacaaccccacc
acgtaccagatggacgtcaaccccaacgggaagtacagcttcggggccacctgtgtgaag
aactgcccccgtaactacgtggtgacagaccacggctcgtgcgtccgcgcctgcagctcc
gacagctacgaggtggaggaggacggcgtccgcaagtgtaaaaagtgcgacgggccttgt
ggcaaagtttgtaacggaataggaattggtgagtttaaagacacactctctataaatgcc
accaacattaagcacttcagaaactgcacctcgatcagcggggacctccacatcctgccg
gtggcattcaggggcgactccttcacacgtactccgcctctggacccaaaggaactggat
attctgaaaaccgtaagggaaataacagggtttttgctcattcaggcttggccagaaaac
aggaccggcctgcacgctttcgagaacctggaaatcatccgtggcaggacgaagcaacat
ggtcagttttctctggcggttgtcggcctggacataacatctttagggctgcgttccctc
aaggagataagtgacggcgacgtgatcatttcaggaaaccagaacttgtgctatgcaaac
acgataaactggaagaaactatttgggacttcgagtcagaaaaccaaaattataaacaac
aggagcgaacaagagtgcaaggccgtgggccacgtctgtaacccgctgtgctcatcggag
ggctgctggggtgcagaccccaaagactgcgtgtcctgcaggaacgtcagccgtggcaag
gaatgtgtggagaaatgcaacgttctggagggagagcccagggaattcgtggagaactcg
gagtgtgtgcagtgccacccggagtgcctgccccaggccatgaacgtcacctgcacggga
cgcggaccgagcagctgtgtaaagtgtgcccactacatcgatggccctaactgcgtgaag
acctgccccgccggcatcgcgggcgagaatggcaccctggtctggaagtttgcggatgcc
agtcacgtgtgtcacctttgccaccccaactgcacctatggctgtgccgggccaggtctc
aaaggctgtgcagagaacaggcccaagattccgtccatcgccaccgggatcgtggggggc
ctcctgatggtcgtggtgctggccctgggggtcggcctcttcctgcgcagacgccacatt
gtccgcaagcgcacgctgcgccggctgctgcaggcggagctggtcgagcctctgacaccc
agcggagaagctcccaaccaagctctcttgaggatcctgaaggaaacagaattcaaaaag
gtcaaggtgctgggctccggagcgttcggcacagtgtacaagggactctggatcccagaa
ggcgagaaggttaaaattccggtcgcgatcaaggagttgagagaagccacgtctccgaaa
gccaacaaggaaatcctggacgaagcctacgtgatggccagtgtggacaaccctcacgtg
tgccgcctgctgggcatctgcctcacctccacggtgcagctcatcacgcagctcatgccc
ttcggctgcctcctggactacgtccgcgagcacaaggacaacatcgggtcccagcatttg
ctcaactggtgcgtgcagatcgcgaagggcatgaactacctggaagaccggcgcttggtg
caccgggacctggcggccaggaacgtactggtgaagaccccgcagcacgtcaagatcacg
gacttcgggctggccaagctgctcggcgccgaggagaaggagtaccacgcggaagggggc
aaagtgcccatcaagtggatggctttggaatcgattttgcaccgaatttacacccaccag
agtgacgtctggagctacggagtcaccgtctgggagctgatgaccttcgggtccaagcca
tatgacggcatcccggccagtgagatctccaccgtcctggagaaaggggagcgcctcccg
cagccgcccatctgcaccatcgacgtgtacatgatcatggtcaagtgctggatgatcgat
gctgacagtcgcccgaagttccgtgagctgatcatcgagttcaccaagatggcgcgggac
ccccagcgctaccttgtcatccagggggacgagaggatgcatttgccaagccctacggac
tccaacttctaccgtgccctgatggacgaagaggacatggacgacgtggtggacgcggac
gagtacctcgtcccccaacagggcttcttccacagccccgccacctcccggacgcccctg
ctcagctctctgagcgccaccagcaacacccccaccgtggcctgcgtggatagaaacggg
cagagctatcccctcaaagaagacagcttcttgcaacggtacagctcagaccccaccggc
accctgaccgaggacagcctcgatgacaccttcctcccggcgcctgagtacgtgaaccag
tttatccccaaaaggccagcgggctctgtccagaaccccgtgtaccacaatcagcctctg
cacccggcgcctggaagagacccccactaccagaactcgcacagcaacgccgtggacaac
cccgagtatctcaacaccgcccaccccgcctgcgtcaacggcgccctctccggccctgcc
ctctgggcgcagaaaggcaccccccagatcagcctggacaaccccgactaccagcaggcc
ttcntcgccaacgccatccttgagggccctgcagctggggatgcaaagtacctaagggca
gcgccagccagcagggacctcactggggcgtga

DBGET integrated database retrieval system