KEGG   Cellvibrio sp. PSBB023: B0D95_08695Help
Entry
B0D95_08695       CDS       T04725                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ceb  Cellvibrio sp. PSBB023
Brite
Enzymes [BR:ceb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B0D95_08695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQT60162
UniProt: A0A1U9N924
LinkDB All DBs
Position
complement(1971842..1972426)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALAPHISAETLEFHYGKHHKTYVDKLNGLVPGTEFEGKSLEEVIKTS
SGGVFNNAAQIWNHTFYWHCLSPNGGGAATGAVADAINAAFGSFDKFKEEFTNSAINNFG
SSWTWLVKKADGSVAIVNTSNAATPLTDASVTPILTVDLWEHAYYIDYRNARPTYMNAFW
ALVNWEFVNTNYAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctgcactgccttacgcgaaagatgcattggctccccatatttct
gctgaaactctggaattccactacggtaagcaccacaaaacctatgttgataagttgaat
ggcctggttcctggcactgaatttgaaggcaaaagcctggaagaagtgatcaaaacctct
tctggtggtgtgtttaacaatgctgcacaaatctggaaccacaccttctactggcactgc
ttgagccctaacggtggcggcgcagcaactggtgctgtagcagatgcaatcaatgctgct
tttggttcgtttgacaagttcaaagaagaattcaccaattctgctatcaacaactttggt
tcaagctggacctggttggtgaaaaaggctgatggttctgttgctattgtgaacaccagc
aatgcggctactccattgaccgacgcctctgttaccccgatcctgactgtggatttgtgg
gaacacgcttactacattgactaccgaaatgcacgcccaacctacatgaacgctttctgg
gcgttggtaaactgggaattcgtgaacaccaattacgccaagtaa

DBGET integrated database retrieval system