KEGG   Caenorhabditis elegans (nematode): CELE_B0218.1
Entry
CELE_B0218.1      CDS       T00019                                 

Gene name
faah-1
Definition
(RefSeq) Fatty acid amide hydrolase 1
  KO
K15528  fatty acid amide hydrolase [EC:3.5.1.99]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0218.1 (faah-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     CELE_B0218.1 (faah-1)
SSDB
Motif
Pfam: Amidase SOAR
Other DBs
NCBI-GeneID: 177613
NCBI-ProteinID: NP_501368
WormBase: WBGene00015047
UniProt: Q17449
LinkDB
Position
IV:join(8159422..8159496,8159697..8160144,8160471..8160826,8160878..8161316,8161475..8161663,8161730..8161941)
AA seq 572 aa
MIFYLVLLVLGAIAFYVHFSNNRKKLIERLEIVAQRRRDDLSKNVEQARKAADKLDTQRR
DWIGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQ
AKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFC
QTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVR
IPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDF
QSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTPTPALQRAVLESKKHLEAAGHTVI
PFYPPRLPSVMQLYFRAVCLDGGQYVLNKLLKDIIEPTIRFQVTLWMVPVWIQRILSYPV
SLVFPRMGMLMQSLTRDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHD
IPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAV
GMPIGVQVAAPPYREEAVLRTMREIEIAVTGK
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgattttttacttggtgcttctcgttttgggagccattgccttttacgttcacttcagc
aataatcgaaaaaagctcattgaacgacttgaaatagttgctcaaagacgacgtgacgat
ctttccaaaaatgtagagcaagctcggaaagctgcagataaattggatactcagagaaga
gattggattggatcacttgattttgagcagctgagagatgaacttcaaagagggcatgtt
acttgtgttgaagctattcgggcatacttccacaaagcaattctagcacatgaaaagaca
aatgcagtcacatgttttatattggatgctgaacgtcaagctgaagaactagatgaacag
gcaaagttaccgtattatgtgaagccgccactttttggagttccattatctctgaaagaa
tgcttgaaagtgaaaggttacgatacgacaagaggttttgtacaagatgcctatcaccct
gcgacagaagattccattcaagtcgagcactataaaaaattaggactaattccattttgt
caaacaaatgttccacaatcacttctcagttacaactgttcaaatcctttattcggaaca
actacaaatccatatgattcaacacgtacttgtggtggatcatcgggtggagaaggtgct
cttattggagccggaggttcattgattggaatcggaactgatgttggtggatctgtaaga
attccgtgtcattttactggaactgccggaattaaaccatcgaaaatgagatttgctcat
cgtggtggtggtgcatcggttcctggaaaaccgttaatagatgctaatgatggaccaatg
gcaaaggatgtgaagactaacgtcgagtttttgagaaatgtttggggagacattgatttc
caatcggatcgtgatccatattgtccaccagttcattggaatgaatctgtttattcaagt
gaaaagaaacttcgagttggatattacattgatgatggatggttcacaccaacacctgca
ctacagagagctgttcttgaatcaaaaaaacatttggaagccgccggacatacagtcatt
ccattctatccaccaagacttccaagtgttatgcagttgtacttcagagctgtatgtcta
gatggagggcaatatgtattgaataaattgttgaaagatatcattgagccaacaattaga
ttccaagttactctttggatggttccagtatggattcaacgtattcttagctatccagtt
tcgttggtattcccgagaatgggaatgttgatgcaatcattgacaagagacacatttgaa
ctccgtgaagcatatgctgatattgaagcctatcgagaggaatttgttggtcttatgatg
aaagataatttggatgtaatcttatgtccagcttccataatgccagctccacaacacgat
attccatcaaaggttgtttctggtgtcagttacacttgtctctacaacttgttagatttt
ggagcaggtgttgttccagtcactgctgtatctaaatctgacgaggagaagttgatcaac
gaatatccagaaactgataaatggtatcaaatcactaaaaaagcaacacttggagccgtc
ggaatgccaattggagttcaagttgctgcaccaccataccgagaggaagcagtacttcga
actatgcgggagattgaaatcgcagtcactgggaaataa

KEGG   Caenorhabditis elegans (nematode): CELE_Y41C4A.2
Entry
CELE_Y41C4A.2     CDS       T00019                                 

Gene name
faah-6
Definition
(RefSeq) Amidase domain-containing protein
  KO
K15528  fatty acid amide hydrolase [EC:3.5.1.99]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y41C4A.2 (faah-6)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     CELE_Y41C4A.2 (faah-6)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 176596
NCBI-ProteinID: NP_499508
WormBase: WBGene00012750
Ensembl: WBGene00012750
UniProt: Q9U2I8
LinkDB
Position
III:join(11650492..11650500,11650677..11650854,11650901..11651013,11651129..11651221,11651371..11651427,11651520..11651727,11651777..11651987,11652530..11652647,11652706..11652903,11652974..11653031,11654736..11654894,11655940..11656103)
AA seq 521 aa
MGNIHQKTAPELQEQDDFETFRRLISSEQLLGDSRVLGKCATELELDDFLRAVVDLDLQS
LIDKLQAKDGLNAYTVLCAYARRMLDCQTRLDCVAGVVMEAFQTAQDTDTLWYNSEEKPP
LYGIPFSIKCDGESGLANSPITTHLRNLGAIPFVTTSISKTPHPRNPWALDCSPGGLCGG
EAALVADGGAPFGFAPDLDAGSLRIASAFCGLVTLKPTRDRFHVSGSNSYGFYTKNVQDQ
VFLLKLFIGSAGYRGLEPMSSPAPLMDLKLENKLKIGWFEDDGFNAPVPSNRRAVVDTIG
LLEKQGYEVVKFEMEDIFPPFQVAQMFFKTQRPVDSNFIPNLYKSNSQCLGRFGKFLNFP
KLVARISKRAAVISQSSNMKEMCKNLEDIESYKLKFIEYWKSLGVDVLICPAFCIPAVPE
KYLPELVNTRLSTGLFNMLDFPAGIVPAGHVTADDVANLEDEKIFPIDDALLRKQRDACV
NSEAMPNSVQIVGLPNEEETVLEVMKIVENLHGPMSNPKGF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggggaatattcatcaaaaaaccgctcctgaacttcaggagcaagatgactttgaaact
tttcgacggctcatctcttcagagcaacttctcggtgattcccgggttctcggaaaatgt
gcgactgaattggagctggacgattttttgagggcagttgtggatttagatttgcaaagc
ttgatcgataaactacaagccaaagacggcctgaatgcgtatacggttttatgcgcctat
gctcgaagaatgttggattgtcagacaaggcttgactgtgtggcgggagttgtaatggag
gctttccaaaccgcccaagatacagacactttgtggtacaactcggaagaaaagcctcca
ctctacgggatcccgtttagtatcaaatgtgatggagaatcaggattggcgaattcccca
ataaccacacatttgaggaacttgggagcgatcccatttgtaacaaccagtatttccaaa
accccgcatcccaggaacccctgggctctcgactgctcgcccggagggctttgtggaggt
gaagctgcactggtggccgacggtggagctccgtttgggtttgcaccggacttggacgct
ggaagtctgagaattgcatcggcgttctgtggactggtgaccttaaaaccgaccagggac
cgattccacgtgtcgggaagtaatagctacggattctacacgaaaaatgtgcaggatcag
gtgttcctgctcaagctttttattgggtcagccggttatcgaggtctcgagccaatgtct
tcgcctgctccgttgatggatttgaaacttgagaataagctgaaaatcggatggtttgaa
gacgatggatttaatgcgccagtgccgtcaaatcgccgagccgtcgttgatactattggc
cttctcgagaagcagggctatgaagttgtcaaatttgagatggaagacattttcccgccg
ttccaagttgcacagatgtttttcaagacccaacggccagtcgactcgaattttattcca
aatctctataaatcaaactcacaatgcctcgggagattcggcaaatttttaaattttccc
aaacttgtcgctagaatttctaaacgagcagcggtgatttcacagagctcgaatatgaaa
gaaatgtgcaaaaatctagaggatattgagagttataagttgaagttcatcgagtactgg
aagagccttggcgttgatgtgttgatatgtcctgcgttttgtatacccgctgttcctgaa
aaatatctacccgaactcgtgaacacccgcctatccaccggcctattcaatatgctggat
tttccggctggcatcgtgccagccggccatgtgacggcagatgacgtggcaaatttggaa
gatgagaagatttttccgattgacgatgcccttctccgaaagcagcgtgacgcatgtgtc
aactcagaagccatgccgaattcggttcaaatcgtcggattaccgaatgaagaggaaact
gtgctggaagttatgaagatcgttgagaatctacatggaccaatgagtaacccgaaagga
ttttaa

KEGG   Caenorhabditis elegans (nematode): CELE_Y56A3A.12
Entry
CELE_Y56A3A.12    CDS       T00019                                 

Gene name
faah-4
Definition
(RefSeq) Monoglyceride lipase faah-4
  KO
K15528  fatty acid amide hydrolase [EC:3.5.1.99]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y56A3A.12 (faah-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     CELE_Y56A3A.12 (faah-4)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 176620
NCBI-ProteinID: NP_001370086
WormBase: WBGene00013232
Ensembl: WBGene00013232
LinkDB
Position
III:complement(join(11899548..11899960,11901245..11901557,11902561..11903271,11904820..11905028,11906427..11906619,11906869..11906877))
AA seq 615 aa
MGNMWGKNRGAVERFQTRREALFDDFKSRSAPASLVNNPRIVKGNETAEQIETTFNEILK
LDLIALKSALQTDKYNAYTVLCAFVWRAIDVNSEINCITEVIREAFNTAEALDDNYAQTG
EKGQLFGLPFSVKSNFYMENYDVTVGLAKLLEQPKTTTCPMVQFLSDQGAVPFCLTNVPQ
GLLSYVSSNPIYGTTKNPWDFSRTPGGSSGGEAALLAAGGAAFGIGSDLAGSLRIPAAFC
GLVTLKPTQDRLCVTDTHGGLPGRGRLGLSFGFYTRSVKEQEFLLGLIVGRSEYLELCPM
SSPAKLEKHIEKDQKLVIGWFVDDGFNPVVPSNRRAVEETVKSLQAKGHQVVELKLADVS
EEFPPFAVADMLFRNVMPDNGAYMSEMYAGEQYDEHMKLFIRLVCLKQNFLVSFLLRYGV
MPFAKLALSKRLACIGSAYNSDLAACRQNQENTDSYKLQWIRYWKSKKIDALICPSFITP
AQPFEYPAQLSNGAFITGLFNMLDVPAGVVPVSPVNQKDVDQLIDGFSTEGDLLLKKQRE
AARGTTGLPNAVQVVTLPNCEEMCLRVMRLVEESAEGVQRLQWRVGASAAPIDVENTPAG
VVSSLEHFERVNLLH
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggggaatatgtggggaaaaaatcgtggagctgtcgaacggttccagactcgtcgtgaa
gcgctctttgatgactttaaatctcgttcggcacccgccagtttggttaacaatccgaga
attgtgaaaggaaacgagacggccgagcagattgagaccactttcaatgagattttgaag
cttgatctgatcgcgttgaagtccgcccttcaaacggacaagtacaatgcctacacagtt
ctctgtgcatttgtgtggcgtgcaattgacgtcaattcggagatcaattgcattactgag
gtcattcgagaagctttcaacacggcagaagctcttgacgataactatgcacagactggt
gaaaaggggcaactctttggtttgccattttctgttaaaagtaacttttatatggaaaac
tatgacgtcaccgtgggtcttgccaaactactggagcaaccaaagacgacgacatgtccg
atggttcagttcctatccgatcagggtgccgtcccattctgcttgacaaatgttccacaa
gggcttctctcctatgtgagctctaatcccatctacggaactacaaagaacccgtgggac
ttctctcgaacacccggtggatcatctggaggtgaagctgcactgcttgccgctggtggc
gccgctttcggaatcggttctgatcttgctggaagtctgagaatcccggccgcgttctgc
ggtctcgtcactctgaaacccacacaggataggctgtgtgtcacagacacccatggaggg
cttccaggccgtggacgccttggattaagcttcggattctatacgagaagtgtgaaagag
caagagttcctacttgggttgattgtgggaagatcggaatatcttgagctgtgtccgatg
tcatcgccagcgaaacttgagaagcatattgagaaggaccagaagcttgtgatcggatgg
ttcgtggatgatggattcaatccagttgtgccatcgaatcgcagagctgttgaggaaact
gtcaagagtcttcaggccaaagggcatcaagttgtggagctcaaattggctgatgtttct
gaagagtttccaccatttgcagtggctgatatgctttttaggaatgtgatgcccgacaac
ggagcatacatgtctgaaatgtatgccggtgagcaatacgacgagcacatgaagcttttc
attcgtttggtgtgtctcaagcaaaactttttggtcagcttcttgctccgatacggtgtg
atgccatttgcaaagttggctctttcgaagaggctcgcttgtattggaagtgcttataat
tcggatttggcggcttgtcggcagaatcaggagaacactgatagctataagctgcagtgg
attagatattggaagagcaagaaaattgatgcattgatttgtccttcttttattactcca
gctcaaccgttcgaatatccggctcaactatcaaatggagcattcataaccggactattc
aatatgcttgatgtcccagctggcgtcgttccagtttccccagtcaaccagaaagacgtt
gatcaattgattgatggattctctaccgaaggagatttgcttctgaaaaagcaacgagaa
gctgctcgaggcaccaccgggttgccgaatgctgtacaggtcgtaactcttccgaattgt
gaagaaatgtgccttcgtgtcatgagacttgttgaagagtcggctgaaggtgttcaacga
cttcagtggagagttggagcatcggcggctccgattgatgtggagaacacgccggctgga
gttgtgagcagcttggagcatttcgaacgtgttaatcttcttcattag

DBGET integrated database retrieval system