KEGG   Caenorhabditis elegans (nematode): CELE_B0348.4
Entry
CELE_B0348.4      CDS       T00019                                 

Gene name
egl-8
Definition
(RefSeq) Phosphoinositide phospholipase C
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00562  Inositol phosphate metabolism
cel01100  Metabolic pathways
cel04020  Calcium signaling pathway
cel04070  Phosphatidylinositol signaling system
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Module
cel_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_B0348.4 (egl-8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_B0348.4 (egl-8)
   04020 Calcium signaling pathway
    CELE_B0348.4 (egl-8)
   04070 Phosphatidylinositol signaling system
    CELE_B0348.4 (egl-8)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0348.4 (egl-8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_B0348.4 (egl-8)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CELE_B0348.4 (egl-8)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    CELE_B0348.4 (egl-8)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    CELE_B0348.4 (egl-8)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_14 DUF1154 EF-hand_like PLC-beta_C
Other DBs
NCBI-GeneID: 178537
NCBI-ProteinID: NP_001300014
WormBase: WBGene00001177
Ensembl: WBGene00001177
UniProt: A0A0K3AXH8
LinkDB
Position
V:join(21007..21090,22495..22856,23159..23294,23562..23645,23793..23896,24788..25259,25965..26129,26194..26380,28382..28699,29336..29515,30200..30297,31340..31582,35015..35156,36118..36855,36918..37213,38138..38269,38991..39026,40454..40723,41729..41844,42040..42166,42214..42317,43026..43170)
AA seq 1512 aa
MAKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVL
DMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVEL
AKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKM
VQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRL
YNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLK
KHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLT
GRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQI
RDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPN
RLRKKILIKNKRLKTDIERHQLDQFLREGKLDEEDELNETPEVVGEDSVSPRSGGSGGTG
APEEVDDDTSDDDDDPSVQTSLNVMRTIPTVNTTSNNGSNRSARSSLDTPSPSGGSLMVP
DRATSTATSIKNAVLARSPNFSSLRQKLSFKRRQSPLAGDQRAHPEVEQPVSSSSPATPS
ISGPPPCATSSGSTSSITITTTGCSTSSSGPSKHILGGEMPAKENDEAHPELKQNFIAKN
LKGFGFSKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFR
QKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLS
SLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKG
ARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRT
FDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGN
GLNPVYNEDPFVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTN
QSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV
PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVD
KFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQPARRRNSSIAWIQ
TNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPS
TPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQL
KEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAER
DRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVGNYK
EEQLAAQPTSVV
NT seq 4539 nt   +upstreamnt  +downstreamnt
atggcaaaggagttccagttcaattggaagcccactattatccctgaacttcttcatgga
tcggttttcgatcgatatgatgatgaaagtacgtgtctggaactaaatgctcaagttcga
attgacgagaacggtttctttctccggtggctgatcgaaggaaaagatgctgtcgtactc
gatatgggccaaatatgggaagctcgcacgggcggcctacccaaagacggccgaattatg
ttcgaattggagcagcgcggagccagcgaaacgatagctgaacgcacgatatggatcacg
catggccaggatttagtcaatgttcagtcgttttttcttgtcgccgaaagtgtcgagttg
gcaaaaacgtgtagagcgggcattaatgatattctaaagtcgtccagaatacgacacgtg
tgtccaactacccaattgatgaaataccatacatggctcaccatgaatgtcaacgaacga
cgaaaaatcccgatcaagttgataatcaaaacattttcgtctggaaaacctgaaaaaatg
gttcaaaagtgtctaaatgacttgggtcttggaggcgataagtacacgccggcacgggtc
atcaatcgatcgatgggcaagaagtttcggaatttctacaagtgcagtcggggacgaaaa
cgaaaggagcgcgaagaacttgacgtcgacatcctcacctttgaaaaattccagaggctc
tataacaagatttgtccgagaaccgaagttcaagagctgtttgttaaattatccggacag
aaagagtacctaaccaaagagcgactcatcaattttctgaatgaagaacaacgtgatcca
cgactcaacgagatcctcttcccattttttgattctcagcgtatcgttgcgcttctcaaa
aaacacgaaaacgacataaaatatcaagaagatggaaaaatgtccggtgacgggtttctc
cgattcctgatgtcagacgagaacccgccagtgtttctagaccgaattgaaatgtttatg
gatatggatcaaccgctgtgtcactactacatcaatagttcccataacacgtatcttacc
ggacggcagtatggtggaaaatcgtcttctgagatttatcgacaagttttgctcagcgga
tgtaggtgtattgagcttgattgttgggatggtactggtgaaaataaaggagaacccatt
atcactcacggaaaggccatgtgcacagacgtgttcttcaaggacgtcctggtacaaatt
cgagacaccgcatttgcccggtcggattttccagtggtcctttccttcgaaaaccattgc
tcaaaatcaaatcagctgaaaatggccaaatattgtatggacatttttggagatatgctg
ctgtccaaaccgtttgaagatgcgcctcttgaccccggagtctccctaccttctccaaac
cgcctgcgaaagaagatccttatcaaaaataagcgattaaaaaccgacatcgaacgtcac
caacttgaccaatttctgcgggaaggcaaactggacgaggaggacgagctgaatgagacg
cccgaagttgtcggagaggactccgtatcacctcgaagcggcgggagcggtggcaccgga
gccccggaagaagtggatgatgacacgtccgacgacgacgatgacccgtcggttcagaca
tcgctgaacgtgatgcgcaccatcccgaccgtgaacaccacatcgaacaacggatcgaat
cgatcggcaagaagttcactggacaccccatccccatccggtgggagcctgatggttcca
gatagggcaacatcgacagcgacgtcgatcaagaacgccgtgctcgcgaggtctccgaac
ttctcctcgttgagacaaaagttgtcgttcaagcggagacaatcaccactagcaggcgat
cagcgtgctcatccggaagtcgagcaacccgtgagctcatcctctccagccacaccgtcc
atcagcggacccccgccgtgtgccacgtcatcaggttcaacgtcatcaatcactattacc
acaacgggatgctccacgtcatcgtcgggaccctcaaaacatattctagggggtgaaatg
cccgccaaggaaaacgacgaagcacatccggagctaaagcagaatttcattgctaaaaat
ttgaaaggattcgggttttcgaaaaaacaacctgattcatccacttcattgctaaccgca
tcaccaacaccgtcctcttcatcgatggccatgtcaaatgcgaataatccgttctcctcc
tcaacccttaactcaccccaaccaatggagaggtctcgaagcgaaaagcgatcgtttcga
cagaaaaagggcggcgttttcggtgacgaactccactcggactcggccgcacttatcgat
tttatgcggacggcgtcgagccgtaagaagaagccggtactgacaaaagaagaagaggag
cggattttcgccgagtatcattataccggggcaactacgaatatacatccgttactctct
tcactggtcaattatacacatcctgtcaagttttctggatttgacgttgcggaagccaac
aacctgcacttccacatgtcctcattttctgagtcaaccggtctcggctacctaaaacaa
tcggcgccggaatttgtgaactacaacaaacgacaatcgagtagaatttatccgaaagga
gccagagttgattcttccaattttttgccgcaaattttctggaacgccggatgtcaaatg
gtgtcgctcaactttcaaactcccgatgtctacatgcaattgaacatgggaaaattcgag
tacaacggtggctcggggtatctgctaaaaccagatttcctccgaagacccgacagaaca
ttcgacccattttccgagagcccggtggacggagtgattgcagcacattgtagtgttcgt
gtcatctcgggtcaattcctatcggatcgcaaaatcgggacatacgttgaggtggaaatg
tacggactacctactgacactattcgtaaggagcacaagacgaaggtaatacccgggaac
ggactgaatccagtttacaacgaggatccgtttgtcttccgaaaagttgtgctccccgag
ctcgccgtgctccggttcgccgtctacgatgagaacggcaagcagctgggtcagcggatt
cttccgctggatgggcttcaggcaggatatcggcatatttcgctgaggtctgacacgaat
cagagcttcattctgtcacctgtgctctttgtgcaaattgtgatcaagacttatgtgccg
gatgagctcagtggcctcgtcgatgctctcgccgacccacgagcattcctctcggagcag
aaaaaaaggcaggaagccctggctcacatgggtgttgacgatagtgatattcctgatgtg
cccaacaccaggaatatggctctccgacacgtgaaacaacctccaaggcagaacggatcg
tcagctgatctgctggcaaacaacggccaaactgggtcggctaggggtgatcagaccagc
tcgatggcttcaagtactattcggtcacccaacgaacaaccgcagccagtggctgtggat
aaatttaaggttgacccaatcgaagttgacgatttacgacgagacaaagcttttgcaaaa
ttgctcaagagatttcaaaaagagttggatgatctcaggaagaaacatcagaagcagagg
gatagcattcaaaaacagcagccggctcgccgccgtaattcgtccatagcgtggatccaa
accaacgtcgacaagctcatcacaaataaccgacgttccacgaaaaaagaaaaaggctca
aggagatccctgacggcttcagtatcatctggatgtggaagtgcatctggaactgtgact
gtcagtgtttgcagtccttctggcgcgagttgcagtgggtactccactgggggtccttcg
acaccggtggcatgtaactctgatggtaccgggtctccagcgactattggaagtccagtg
ccacaagatttggtcaataatgatagggtccgatctctcgtgaacactcaaaccggagaa
tggtccgctatggtccgtagacatgacgaggaagagtttgagctgaaaaaagtacagctc
aaagagcaattcgatctgctaagaaaactcatgagtgaagctcaaaagaaccaaatgttg
gctctgaagctccggttagaagccgaagggaaagatctaaagcagacgcagacgaaaaaa
agcatggaagatgcgaaagttattcaattggacaaaggtattaagaccaaggcagaacgt
gatcgtcgtgtcaaggaactcaacgagaagaacctgaaaatgtttgtggaggagaggaag
agattagccatgaaagcccaaaagcacgaagagcaactcacaaaacgacatctcgaccag
ctcgagcaactagacaaggatttccataaggccttggatgcggaggtcggcaactacaaa
gaagagcaactggctgctcaaccgacttctgtcgtttga

DBGET integrated database retrieval system