KEGG   Caenorhabditis elegans (nematode): CELE_C01B7.6
Entry
CELE_C01B7.6      CDS       T00019                                 

Gene name
rpm-1
Definition
(RefSeq) E3 ubiquitin-protein ligase rpm-1
  KO
K10693  RCR-type E3 ubiquitin transferase [EC:2.3.2.33]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C01B7.6 (rpm-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_C01B7.6 (rpm-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.33  RCR-type E3 ubiquitin transferase
     CELE_C01B7.6 (rpm-1)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CELE_C01B7.6 (rpm-1)
SSDB
Motif
Pfam: PHR RCC1 RCC1_2 ANAPC10 zf-RING_2 zf-B_box SH3_3 Filamin zf-RING_11 SCNM1_acidic
Other DBs
NCBI-GeneID: 179259
NCBI-ProteinID: NP_505267
WormBase: WBGene00004457
Ensembl: WBGene00004457
UniProt: Q17551
LinkDB
Position
V:complement(join(8805672..8805879,8805957..8806102,8806152..8806889,8806933..8807499,8807562..8808248,8808299..8808475,8808531..8809490,8811192..8811737,8811790..8813832,8813883..8817676,8817728..8817872,8818019..8818463,8818602..8819035,8819477..8819700,8819769..8819955))
AA seq 3766 aa
MSFFLREIDGERVCSTSTETSIPEDRKSARRLRKLLYKCAENTCKPDILRVPAHCGKLDK
EEEKSKTPLDQQQQINFHDILNSKFVVGPPSPFALVAIAKSILARFGNPEEVSEKEDGSE
EEAGTSGADEEGKQYKNTDQLVGASLTCIFEVLEQLSRRDAELCVQALESLLSLIQSMPI
DCLQSENRLSMSAMMHVLKTLREDACPSVSSKATSCLVALSVACGEPEHLGSTIRSLICM
KKNIRMSADSTYDMIQMPENLRKLLLKVRRKALGGDNTANSPPNWAMVDVHEHSVASSFS
LPSLPDSSPSSDTPDDDNRIHSTMACDGTFLYILNYVGLYKLGTGLNETISGKLYAANQS
LQSSKNVQMYLCNGSLYLRRNYSSCISVIDTDSLLDIGEVILPPSCVQHALFTDGTYFYS
ATLIANSTLSTIQLNDSFSPSNEPSSRRSHRLTDVKFTIQGDLQVPHQLPEFLPANLHPQ
TVDLHFTREMAFIQARSGKVYYAGNGTRFGLFETGNNWMELCLPEPIVQISVGIDTIMFR
SGAGHGWIASVDDKKRNGRLRRLVPSNRRKIVHVCASGHVYGYVSENGKIFMGGLHTMRV
NVSSQMLNGLDNVMISSLALGKSHGVAVTRNGHLFTWGLNNMNQCGRVESTSTTSSPRHS
GRQEYQICPIGEHTWLTDTPSVCAQCGLCSARGVACGRVPRPKGTMCHCGVGESTCLRCG
LCRPCGEVTEPAQPGRAQHVQFSSTAAPQRSTLHPSRVILSQGPHDVKVSSVSCGNFHTV
LLASDRRVFTFGSNCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSV
FTFGAFGKGQLARPAGEKAGWNAIPEKVSGFGPGFNAFAGWIGADGDSSIIHSHTALLSS
DNILKAQIVANKTNIFIFPREVGKDYIVIRRKLNVFEHHASDYKCWYTSWATDPKYDMLW
YYNSAEMEIKGYDIFKKSEKSVGDAFDSLTFLAGAEFAVQVYDSPAYATSMSLGMQLLSA
TFSANVINLSEFWKEKHGEREQDHEKTIMDGYSVANRFDGTGGGWGYSANSVEAIQFKVS
KEIRLVGVGLYGGRGEYISKLKLYRQIGTEADELYVEQITETDETVYDCGAHETATLLFS
QPIVIQPNHWHVVSAKISGPSSDCGANGKRHVECDGVTFQFRKSAVSNNGTDVDVGQIPE
LYYQIVGGSESRDESDSNKQLSISRDMSNLFSPAALKNVTAEGIGNLLILLEWALQRVQI
DEDTNNQVEGSAENQWSQERAGFVAILSMKLISRFVRTVYKEKGCHDEPGIDFANKLVNL
HSMLLEFFFSTDMTGYENRPLIKKEEKVVEEGYTLMKCVSEAVKLFISLSHCFMGSRSLM
NAHLIAVMNKGNHEALILTSAIIGSLAKIERFAHQLLCSTTTTERFPMLSSLLLKHFNCE
KETLASLTSFPNILRFLYDQTFMRNAYENTSSLAEAILVKVSRDLAIPTDDTLMGPVVHQ
TSSRFRRRSAQPTWDMSDGCADAIAFRVDSEGIKLHGFGIYLPTEPDRRNFVGEIMMLSP
DSSEKWTCLLRVTAEMSSEEKEVGIVRFPEYVLLSPGVTYAVKVNMMKNTKTFCGEGGVT
QVHLLNGARLFFSGCSMSQNGTTVQRGQLPYLIYSILDQSNSLQIKQETIYDTFTLLLRL
MANKIGAAITEGGALPACCQHLMSHINPHVMVYMERFPDKALEMMSTMEQLIPMVSNLNG
VERVFHSYDSDDSGCDTPYSGIVTTVVESQHPYKPNTSSSMVLLFEEADYICVRFSPDCQ
TAQFDDQLTIYLKIDEHSYMPIERCYGSEWPSYPMILPGNCLMFVLDASSAVEGATSEQM
FGYHVTVTGYLVGYNDSTMRLEQDLVWLSANACRIMTQLPINPSNIEHLSTAEDDTRHLF
EKHGSLLKKGLSLSHSPTLSELCTKGQPPPAQSADLQFLREFLSGHTSTSAGFLAKWLPT
GSVVDASKCQLSLSHDDLIVGKAVTLKLLCKDQYDREVDCPKLQVEVFASLGHRNPSSTI
HQNLHIGNLPSSLLIHQNPFQPIIVNHTRYMNIAAMPAYANYSVEEIRLGFMIEELVKDR
VPLKSSDSSLFSGTWTPTTAGKYRIECKVDGSDISHTYTVEVTERPHRAGKGTITKPSGS
RRGAQMTVARTVSIPFSSDFSGIRMRLGTTLASTSVGVIPRGALVEFIEEMDNDDGKWIR
LTDETALLYGCNQGVGQVWCLAYHRPLQRELIPLKADTDREKAVKLRRKEIEKESNGSKH
HSVSIDAKETYILSPNDVLQVYSTPAPHSMIDGEKIIGPCDLMSSGWLANRHGVWIKLTG
VEKYVLQKNDPSSETSLSFSTNGNDEEDLERPIERKKTRLPNALTPSVADCIRAVFAAFV
WHEHLVKDLMAAAAYLRFHQNLHNIWQSCEIPSCTNAPAALQPIVKIWREICEVVETSVE
QHLIMPPVSNKAMRAETVKPPSRSGGCELCDANITVPLTVHLRMAHPGCGGDCLGYGYNS
NGKFTTGWSGECGAGGRGQSPWYLLCNTCRSQYLKKTPAGHHQERTRRWREFRFSTSASD
ARPEVIIRQNAMFLLDLNSRLQTESNSSSTATSGWTINLFPTHLSTPSTMPRSQQKRLDV
PPNNSVHQNSYMKLGYSSDPGPKVNVIMSPPNQGADQSASLNRPGPSAINEPAEVLQSPS
AALRTLFSNTNPSTSALLKRPVLAFCVEHHDLKRIKSACVQSVRRAVAFSHAFRVWNWLL
RMVSSEYSVSDIILQYLTTLTSYNRLAEYMFSAKKNSNILPHPWRLCFLAGPIAADMVTQ
LHAFLHTVSIILQSAGVDGRLKSLCFKSWTLQLTAQEQDLLILTCNILGTVGGILSDTSI
LDSDNRFVKEMKDITKFADITASSRQAMVICLTDESGETFWESGEEDKNRSRSLSVQLDE
SAHGEILSLFIDNARDEGYRISSIAFKAILEDGRRKDLTSLTLESAYCGWLKCCIKDISH
IQIQFKGPNPASRIRQLMILGYPAKTTGTPRLAPSTSHHLFFSDTQRDAFALFQAISSQA
FCGELSEDDTLRERVIDLLFSRVQLYPLQNYVYTQVVQAMEKEVELLCDKSKRNYSYCCG
LMSLLVRICDSRGNMDSFGQRNSVLTSITQLLIFSPVVVQRQCLNSLECIFASFTPSNVE
VPKIIRNLLVVVGKVIQLQVRDKAAHTVVTVHLCSSVLNAPQNWRVDKSIDMDIGRQTAV
LVENLCNGTYTPEWSNATKCELANCLLSLIQMPESVSYTETLSTGGKSKAVAVVSSKRFW
TAISSLSLIKDKSWLELSERWKTVQDEEDQEPVLLCENHDDGHTVAQVFCVDCDVALCKE
CFTVMHLHKKNRNHGVKNLVQSSTQHDINIHQGCARMKFLNFLILFHGEALNGMVEVAAD
TLFPTSTSSIQPAMQSSSAFLGIHPMTCRFCGNNVPVEDQSLDGTCTHEDCVNYAKTACQ
VMHTCNHFCGGIRNEEECLPCMTCKREDAAQDGDDVCVICFTERLGAAPCIRLGCGHMFH
FHCVRMILERRWNGPRIVFRFMQCPLCIQPIEHSGLQDLIEPLKTIRQEVVDKAKMRLEY
DGLLTTPALTDPRSEFYNQPEEYALDRYMYVLCHKCKKAYFGGESRCQAALDSSQFNPEE
LLCGGCSDTSGVQVCPRHGVEYLEYKCRFCCSIAVYFCFGTTHFCAPCHDDFQRLMSLPK
HLLPTCPVGPRSTPMEEQTCPLKMKHPPTGDEFAMGCGICRNISTF
NT seq 11301 nt   +upstreamnt  +downstreamnt
atgtcgttcttcttgcgagaaattgatggtgaacgagtgtgttccacgagcaccgaaacg
tcgattcctgaagataggaaaagtgcacgaagactgagaaaattgctatacaaatgtgcc
gagaacacatgcaaaccggatattctcagggttccagcacattgcgggaaactcgataaa
gaagaagagaaatccaaaacacctctggaccagcaacaacaaattaattttcatgatatt
ctgaactcaaaatttgttgtgggaccaccttcgccttttgctttagtagcaattgccaaa
tcaattcttgcacggtttgggaatccagaagaagtttctgaaaaagaagatggaagcgaa
gaggaagccggaaccagtggagctgatgaagagggaaagcaatacaaaaatactgatcag
ctggttggagctagtttaacatgtatcttcgaagttctcgagcaattaagtcgacgtgac
gccgaactttgtgttcaagctctcgaatcattgttatcattgatccaatcgatgccaatc
gattgtcttcagtccgaaaaccgtttatcaatgtctgcaatgatgcacgttctgaaaacg
cttcgagaagatgcctgtccctcagtgagctcaaaagctacctcatgccttgtggcttta
tcagttgcatgtggagagccggagcatttaggaagcacaattcgatcattaatttgtatg
aagaaaaatattcgaatgagcgccgattcgacgtatgatatgatccaaatgccagaaaat
ttgagaaaattactactgaaagtgaggaggaaagctttaggcggagacaacactgccaat
tccccaccaaactgggcaatggtagatgttcacgagcactcggtagcaagcagtttcagt
ctacctagtcttcctgatagctctccgtcttccgacactcccgacgatgacaatcgaata
catagcacaatggcatgtgatggaacatttctctacattcttaattatgttggactctac
aagttggggaccggcctgaatgaaacaatttctggaaagttgtatgcagcgaatcagagt
ttacaatcgtcgaaaaatgtgcaaatgtatttatgcaatggatcattgtatttacgaaga
aattactcatcatgcatatcagtgattgacacggattcattgttggatattggagaagtg
attctaccaccaagttgtgtacaacatgcactgttcacggatggaacatacttttacagt
gcaactctgattgccaattctacactatcgacaattcaactaaatgattcattttcccct
tccaatgagccatcatcacgaagaagtcatcgactcactgatgtgaagttcacgattcaa
ggagatcttcaagttcctcaccaactccccgaatttctacctgcaaaccttcatcctcaa
actgttgatcttcacttcactcgagaaatggcattcattcaagctcgctctggaaaagtg
tactacgctggaaacgggacaaggttcggattatttgaaactgggaacaactggatggaa
ctgtgtcttcccgagccaatagttcaaatttctgttggaattgatacaataatgtttcgt
tctggtgcagggcatggttggattgcaagtgtagacgataagaaaagaaatggaagacta
cgtcgacttgttccatctaatcgccggaaaattgttcatgtttgcgcctctggtcatgtc
tatggatatgtatctgaaaatggaaagattttcatgggaggacttcatacaatgagagtg
aatgtttcaagtcaaatgttaaatggactggataatgtgatgatttcttcattagcgctt
ggaaaatctcacggtgttgctgtgactcgaaatggccatctttttacatggggattgaac
aatatgaatcaatgtggaagagttgaatcaacttcaaccacgtcttctccaagacattcc
ggtcgtcaagagtatcagatttgtcctatcggagaacacacgtggctaactgacacaccc
tcggtatgtgctcaatgcgggctttgctccgcacgaggagtagcatgtggaagagttcct
cgaccaaagggaaccatgtgtcattgcggtgttggagagtcaacatgccttcgatgtgga
ctttgcagaccatgtggagaggttacagaaccagcacagcctggtagagctcagcatgtg
caattcagttcaacagctgctcctcaaagaagtactctacatccgtcacgtgtaatttta
agtcaaggacctcatgatgtaaaagtttcaagcgtaagctgtggaaattttcatacagta
cttcttgcatctgatcgaagagttttcacttttggatccaactgccatggccaattagga
gttggagatacacttagcaaaaacactccgcagcaagtcattcttccatctgatacagtt
atagtccaagttgccgctggttcaaatcacacaattttgagggcaaatgatggaagcgtt
ttcacatttggtgcatttggaaaaggtcagctagcacgaccagctggcgagaaagctgga
tggaatgcgatccctgaaaaagtttctggttttggtcctggattcaatgcattcgctgga
tggatcggagccgatggtgattcttcaatcatccatagtcatacagctttattatcttct
gataatattctgaaagctcaaattgttgcaaacaaaacgaatattttcattttcccaaga
gaagttggtaaagactacattgtaataagacgaaagttgaatgtttttgaacatcatgcg
agcgattacaaatgttggtatacatcatgggccactgatccgaagtatgacatgctgtgg
tattacaattcagcagaaatggaaatcaaaggatatgacattttcaaaaaatctgaaaaa
tctgtgggcgatgcatttgattccctaactttcctagctggtgccgaatttgctgtccaa
gtgtacgacagtcctgcttatgcaacttcgatgagtcttggaatgcaacttttatcagca
acattctcagcaaatgttatcaatttatctgaattctggaaggaaaaacatggggaacga
gaacaggatcacgagaaaacaattatggatggttattcagttgcaaatcgatttgatggt
acgggaggtggttggggatactcggcaaattctgttgaagctatccaatttaaagtctcc
aaggaaattcgattagtaggagttgggctgtatggaggacgaggagaatacatatcgaag
ctcaagttatatcgacaaattggaacagaagctgatgagttatatgtggagcagatcact
gagactgatgaaacagtttatgattgtggagcacatgagactgcaactcttttattctca
caaccaatagttattcaaccaaatcattggcatgtagtcagtgcaaagataagtggtcct
tcttctgattgtggagcaaatggaaaacgtcatgtcgagtgcgatggagtaacatttcag
tttcgaaaatctgctgtgtcaaacaatggaactgacgtagatgttggacagattccggag
ctgtattatcaaattgtcggtggatctgaaagtcgtgacgaatcggattcgaataaacag
ctgtcaatcagtagagacatgtcaaatctcttttcacctgctgcactgaaaaatgtcaca
gcggaaggaattggtaatttgctgatacttttggagtgggctttacaacgcgttcaaatt
gatgaagatacaaacaatcaagttgaaggaagtgctgaaaatcaatggagtcaggaaaga
gcaggatttgttgctattttaagcatgaagcttatatcaagattcgtaagaacagtgtac
aaagagaagggatgtcatgatgaaccaggaattgattttgctaataagttggtaaatctg
cactcaatgctcttagaattcttcttttcaaccgatatgactggatatgaaaatcgtcca
ttaattaaaaaagaagaaaaggttgttgaagaagggtatactctgatgaagtgtgtgtcg
gaagcggttaagctattcatttctctttctcactgctttatgggatcaagaagtctcatg
aatgctcatcttatcgctgtcatgaacaaaggaaatcatgaagctttgatcctaacatct
gcaattattggatcccttgctaaaattgaacggtttgctcatcaacttctatgctcgact
accacaactgaaagatttccaatgctgtcatcacttcttctgaaacatttcaattgtgag
aaagaaacactcgcgtctctcacttcatttccaaatattcttcgatttctttacgatcaa
acttttatgagaaatgcgtacgaaaacacgtcaagtttggctgaggccattttggtcaag
gtatcgagagatcttgccattccgacagatgatactcttatgggaccagtagtacatcaa
acttcgtcgaggttcagaagaagaagtgcacaacctacttgggatatgtctgatggatgt
gcagatgcaattgcttttagagtggactccgaagggataaaattacacggttttggaata
tatcttccaactgaaccagaccgacggaatttcgttggagaaataatgatgttgtctcca
gattcatctgaaaaatggacatgccttcttcgggttactgctgaaatgtcgtctgaagaa
aaagaagttggaattgttagatttccagaatatgtacttctttctccaggtgtcacttac
gctgtcaaagttaacatgatgaaaaatacaaagacattctgcggagaaggtggagtcact
caagtgcatctactcaatggagcccgcttgtttttctcaggatgctcaatgagccaaaat
ggaacaacagttcaacgcggacaactaccatacttgatatattcaatccttgatcaatca
aacagtcttcaaataaaacaagaaacaatttatgatacattcactctacttcttcgattg
atggctaacaaaattggtgccgcaataacagaaggtggagcacttcctgcatgctgtcaa
catttgatgtctcatataaatcctcatgtcatggtatacatggaaagattcccagataaa
gctttagagatgatgtcaacaatggaacagttgatcccaatggtttcaaatttgaacgga
gttgaaagagttttccattcatacgattcagatgacagtggctgtgatacaccatattct
ggaattgtgacaactgtggttgagagtcaacatccatacaaaccaaatacatcaagctca
atggttttgttgttcgaggaagctgattacatttgtgtccgattttcaccggattgtcaa
actgcacaatttgatgatcaactgacaatttatctcaaaatcgatgagcattcttacatg
ccaattgaacgttgttatgggagcgaatggccgtcctatccaatgatattgcctggaaac
tgtctgatgtttgttttggatgcatcttctgctgttgaaggtgcaacttctgaacagatg
ttcggttaccacgtgacagtaaccggatatttagttggttacaatgattctactatgcga
ctggaacaagatctcgtttggttgtcagctaatgcttgtcgaataatgacacaattaccg
atcaatccgagcaacattgaacatttgagcacagctgaagacgacactcgtcatctattt
gagaaacacggaagtcttctgaaaaaaggtcttagcttgagtcattcaccaactctcagt
gagctgtgtacaaagggacaaccacctccagcacaatctgctgatcttcagttcttacga
gaatttctttctggacatacatcaacatctgctggatttttagcaaagtggcttcctact
ggatctgttgttgatgcttcaaaatgtcagctatccttatctcacgacgacttgattgtt
ggaaaggcagttactttgaaacttctatgcaaggatcaatatgatcgagaagttgactgc
ccgaagcttcaagttgaagtatttgcctcgcttgggcacaggaatcctagttccactatc
catcaaaacctgcacattggaaaccttccgtcctcacttttaatccaccagaatccattc
caaccgattatcgttaatcacacaaggtatatgaatattgctgcaatgcctgcatatgca
aattattccgtggaggagattcgattgggattcatgatagaagaacttgtcaaagatcgg
gttcctttaaaatcatctgattcttccttgttctctggtacttggactcccactactgct
ggcaaataccggattgaatgcaaagttgacggatctgatatttcccatacctacactgtt
gaagtaactgaacggcctcatcgagctggcaaagggacaattacgaagccaagtggaagc
cgacgtggtgcacagatgactgtagcgagaactgtttccattccgttttcaagtgatttc
tcaggaatacgaatgcgattaggaacaacgttagcatcaacatcagtgggtgttatacca
cgtggagctttggtggagtttattgaagaaatggacaatgatgatggaaaatggattcgg
cttacggacgaaacagcgttactgtatggatgcaaccaaggagttggccaagtttggtgt
cttgcttatcacagaccacttcaacgagaattaattccactgaaagctgatacagatcga
gagaaagctgtgaagttaagacgcaaggaaattgaaaaagaatcgaatggaagtaagcat
catagtgtttcaattgatgcaaaggaaacatatattttatcaccaaatgatgttcttcaa
gtatattccactcctgcacctcattcaatgattgacggtgagaaaattattggaccttgt
gatttgatgagcagtggctggttagcaaatcgtcatggagtctggataaaactcactggc
gttgagaagtatgtgctccaaaagaatgacccatcttctgaaacgtcactgagcttttcg
acaaatggcaatgatgaagaagacttggaaaggccgattgaacgaaagaagacaaggctt
ccaaatgctttgacaccatcagttgctgattgtattcgagcagtatttgcagcatttgta
tggcacgaacatttagttaaggatttaatggcagcagcagcatatttgagatttcatcaa
aaccttcataatatctggcagtcctgtgaaattccgtcgtgtactaatgctcctgcagct
ctccaaccaatagtgaaaatttggagagaaatatgtgaagtcgtggaaaccagtgtagag
cagcatttgataatgcccccagtttcaaacaaagccatgcgtgcagaaactgtgaagcca
ccatcacgaagcggtggatgtgaactttgtgatgcaaacattactgttccattgactgtt
catctccgaatggcacatcctggttgtggaggagattgtcttggatatggttacaactca
aatggaaagttcaccactgggtggtctggagagtgtggagctggtggtagaggacagtct
ccttggtatttgttatgtaatacctgtcgatctcaatatctcaagaaaacaccagctggg
caccatcaagaaagaacaagaagatggagagagtttagattttcaacatcagcatcagat
gctagaccggaggttattattcggcaaaatgcaatgttcctgttggatttgaatagtaga
ttacaaacagaatcaaatagttcgtcaacagctacatctggatggaccattaatctcttc
ccaactcacttgagcaccccctcaacaatgcccagaagtcaacagaaaagattggatgtt
cctccgaacaactccgttcatcagaattcttacatgaaacttggatattcctcagatccc
ggcccaaaagtcaacgtgatcatgtcgcctccaaaccaaggcgcagatcaatcagcttca
ttgaacaggcctggtccttcagcaattaacgagcctgccgaagtcttgcagtctccatca
gctgctcttcgaacgttattctcaaacaccaatccatcaacctctgcacttttgaaacgt
cctgttctagcattttgcgtagagcaccacgatctgaagagaattaaatctgcatgcgtt
caatctgttcgtcgagctgttgcattttctcacgcatttcgtgtctggaattggctactt
cgaatggtttcatctgaatacagtgtgtctgatatcattctacagtatctaactacgttg
acatcttataatcgacttgctgaatacatgttctctgccaagaaaaactcaaacattttg
cctcacccatggagactttgttttttagccggtccaattgctgctgacatggtcactcaa
cttcacgcattcctccatactgtttcgattattttgcaatctgccggagtagatggtaga
cttaaatcgttatgcttcaagtcttggacacttcaactgactgcacaagagcaagatttg
ctgattctgacatgcaacatacttgggactgtcggtggtattttgtcagacacttcaatt
cttgattccgataaccgatttgtgaaggagatgaaagatataacgaagttcgcggatatc
actgcgagtagcagacaagcaatggtaatttgtttgactgatgaaagtggagaaacattt
tgggaaagcggagaggaggacaagaatcgaagccgttccctatcagttcagcttgacgaa
agtgctcatggcgagatcctctcactttttatagataatgcccgagatgaagggtaccga
atcagttcgattgcttttaaagcaattctcgaggacggtaggagaaaggatctgactagt
ttgactcttgaatccgcatattgtggatggttgaaatgttgcatcaaagacatcagtcac
attcaaattcaattcaaaggaccaaacccagcatctcggattaggcagctgatgattctc
ggttacccggcaaaaactactggaaccccgagattagctccatctacttcccatcattta
ttcttcagcgatactcaacgtgacgcgtttgcacttttccaagcaatatcatctcaagcc
ttttgtggcgaactatccgaagatgatactctaagagaacgggttatagatttactattc
agtagagttcaactttatccacttcaaaattacgtgtacactcaagttgttcaagcgatg
gaaaaagaggtcgagctgctttgtgataaatcgaagcgaaattattcgtattgttgtgga
ttgatgagtttgttggtcaggatttgtgactcaagaggcaatatggatagttttggacaa
agaaattcagttctaacttcaattactcaacttcttatattctccccagtggttgttcaa
agacaatgtctcaattctttggaatgtatttttgcatcattcactccaagtaatgtagag
gtaccaaaaattattcgcaatcttctggtcgtcgttggaaaagttattcaacttcaagtg
agagacaaagcagcccatacagttgttactgttcatctttgttcatctgtcttgaatgcg
cctcaaaattggcgagttgacaaatcaatcgatatggacattggacggcaaaccgcagta
cttgttgaaaacctttgcaatgggacatatacgccagaatggtcaaatgccacaaaatgt
gaattggccaattgccttctgagtttgatacaaatgcctgaatcggtgtcttacacggaa
acattgtcaactggaggaaagagtaaagcagtcgctgtggttagctcaaaacgtttttgg
acagcaatctcatcactatcgctaatcaaggacaagtcatggttggaactttcggaacga
tggaagacagttcaagatgaagaggaccaggaaccggttttattgtgtgaaaatcatgat
gatggacataccgtagcacaagtgttctgtgtggattgtgatgtggcactgtgcaaagaa
tgtttcacagtgatgcatttgcataaaaagaatagaaatcacggagtgaaaaatctagtg
caatcgagtacccaacatgatatcaatattcatcaaggatgtgcgagaatgaagttcctc
aactttttaattctattccacggagaagctctcaacggaatggtagaagtcgccgctgac
actctctttcccacgtcaacttcttccatacaaccggcaatgcaaagttcaagtgcattt
cttggcatccatcccatgacatgtcggttctgtggaaataatgttccagtggaagatcag
agtcttgatggaacttgtactcatgaggattgtgttaattatgcaaaaaccgcgtgtcaa
gtaatgcatacttgcaaccatttctgtggtggaattcgaaacgaagaagaatgtcttccg
tgtatgacctgtaaacgagaagatgcagctcaagatggagacgatgtttgtgtaatttgt
ttcactgaaagacttggagcagcaccatgtattcgcctcggatgtggtcatatgttccat
ttccattgtgttcgaatgattttggaaagaagatggaatggtccaagaattgttttccgt
tttatgcagtgtccattgtgcattcaacctattgaacattctggattacaagatcttatc
gaaccattgaaaacaattcgacaagaagttgtagataaagcaaaaatgcgtttggaatat
gatggtctccttacaactccagctctaactgatccaagatccgagttttacaatcaacca
gaggaatatgctcttgatagatatatgtatgtcttgtgtcacaagtgtaagaaagcctac
tttggtggagaaagtcgttgtcaagccgcattagatagctcgcagttcaatcctgaagaa
ttactatgtggtggttgttcagatacaagcggagttcaagtctgcccaagacatggagtc
gaatatctggagtacaaatgccgattctgttgctctattgctgtttatttctgttttggt
acaactcatttctgcgcaccttgccatgatgacttccagcgtttaatgtctcttccaaaa
catcttcttccaacatgtccagttggccctcgatcaacaccaatggaagaacaaacatgc
cccctgaagatgaagcatcctccaactggtgatgaatttgcaatgggttgtggaatttgt
agaaatattagtactttttga

KEGG   Caenorhabditis elegans (nematode): CELE_F07B7.12
Entry
CELE_F07B7.12     CDS       T00019                                 

Gene name
F07B7.12
Definition
(RefSeq) Uncharacterized protein
  KO
K10693  RCR-type E3 ubiquitin transferase [EC:2.3.2.33]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F07B7.12 (F07B7.12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_F07B7.12 (F07B7.12)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.33  RCR-type E3 ubiquitin transferase
     CELE_F07B7.12 (F07B7.12)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CELE_F07B7.12 (F07B7.12)
SSDB
Motif
Pfam: PHR RCC1 RCC1_2 DARPP-32
Other DBs
NCBI-GeneID: 184118
NCBI-ProteinID: NP_001343654
WormBase: WBGene00017190
Ensembl: WBGene00017190
LinkDB
Position
V:complement(join(8855261..8855926,8855977..8859770,8859822..8859966,8860113..8860557,8860696..8861129,8861571..8861794,8861863..8862049))
AA seq 1964 aa
MSFFLREIDGERVCSTSTETSIPEDRKSARRLRKLLYKCAENTCKPDILRVPAHCGKLDK
EEEKSKTPLDQQQQINFHDILNSKFVVGPPSPFALVAIAKSILARFGNPEEVSEKEDGSE
EEAGTSGADEEGKQYKNTDQLVGASLTCIFEVLEQLSRRDAELCVQALESLLSLIQSMPI
DCLQSENRLSMSAMMHVLKTLREDACPSVSSKATSCLVALSVACGEPEHLGSTIRSLICM
KKNIRMSADSTYDMIQMPENLRKLLLKVRRKALGGDNTANSPPNWAMVDVHEHSVASSFS
LPSLPDSSPSSDTPDDDNRIHSTMACDGTFLYILNYVGLYKLGTGLNETISGKLYAANQS
LQSSKNVQMYLCNGSLYLRRNYSSCISVIDTDSLLDIGEVILPPSCVQHALFTDGTYFYS
ATLIANSTLSTIQLNDSFSPSNEPSSRRSHRLTDVKFTIQGDLQVPHQLPEFLPANLHPQ
TVDLHFTREMAFIQARSGKVYYAGNGTRFGLFETGNNWMELCLPEPIVQISVGIDTIMFR
SGAGHGWIASVDDKKRNGRLRRLVPSNRRKIVHVCASGHVYGYVSENGKIFMGGLHTMRV
NVSSQMLNGLDNVMISSLALGKSHGVAVTRNGHLFTWGLNNMNQCGRVESTSTTSSPRHS
GRQEYQICPIGEHTWLTDTPSVCAQCGLCSARGVACGRVPRPKGTMCHCGVGESTCLRCG
LCRPCGEVTEPAQPGRAQHVQFSSTAAPQRSTLHPSRVILSQGPHDVKVSSVSCGNFHTV
LLASDRRVFTFGSNCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSV
FTFGAFGKGQLARPAGEKAGWNAIPEKVSGFGPGFNAFAGWIGADGDSSIIHSHTALLSS
DNILKAQIVANKTNIFIFPREVGKDYIVIRRKLNVFEHHASDYKCWYTSWATDPKYDMLW
YYNSAEMEIKGYDIFKKSEKSVGDAFDSLTFLAGAEFAVQVYDSPAYATSMSLGMQLLSA
TFSANVINLSEFWKEKHGEREQDHEKTIMDGYSVANRFDGTGGGWGYSANSVEAIQFKVS
KEIRLVGVGLYGGRGEYISKLKLYRQIGTEADELYVEQITETDETVYDCGAHETATLLFS
QPIVIQPNHWHVVSAKISGPSSDCGANGKRHVECDGVTFQFRKSAVSNNGTDVDVGQIPE
LYYQIVGGSESRDESDSNKQLSISRDMSNLFSPAALKNVTAEGIGNLLILLEWALQRVQI
DEDTNNQVEGSAENQWSQERAGFVAILSMKLISRFVRTVYKEKGCHDEPGIDFANKLVNL
HSMLLEFFFSTDMTGYENRPLIKKEEKVVEEGYTLMKCVSEAVKLFISLSHCFMGSRSLM
NAHLIAVMNKGNHEALILTSAIIGSLAKIERFAHQLLCSTTTTERFPMLSSLLLKHFNCE
KETLASLTSFPNILRFLYDQTFMRNAYENTSSLAEAILVKVSRDLAIPTDDTLMGPVVHQ
TSSRFRRRSAQPTWDMSDGCADAIAFRVDSEGIKLHGFGIYLPTEPDRRNFVGEIMMLSP
DSSEKWTCLLRVTAEMSSEEKEVGIVRFPEYVLLSPGVTYAVKVNMMKNTKTFCGEGGVT
QVHLLNGARLFFSGCSMSQNGTTVQRGQLPYLIYSILDQSNSLQIKQETIYDTFTLLLRL
MANKIGAAITEGGALPACCQHLMSHINPHVMVYMERFPDKALEMMSTMEQLIPMVSNLNG
VERVFHSYDSDDSGCDTPYSGIVTTVVESQHPYKPNTSSSMVLLFEEADYICVRFSPDCQ
TAQFDDQLTIYLKIDEHSYMPIERCYGSEWPSYPMILPGNCLMFVLDASSAVEGATSEQM
FGYHVTVTGYLVGYNDSTMRLEQDLVWLSANACRIMTQLPINPSNIEHLSTAEDDTRHLF
EKHGSLLKKGLSLSHSPTLSELCTKGQPPPALKHFTYTYSEPQF
NT seq 5895 nt   +upstreamnt  +downstreamnt
atgtcgttcttcttgcgagaaattgatggtgaacgagtgtgttccacgagcaccgaaacg
tcgattcctgaagataggaaaagtgcacgaagactgagaaaattgctatacaaatgtgcc
gagaacacatgcaaaccggatattctcagggttccagcacattgcgggaaactcgataaa
gaagaagagaaatccaaaacacctctggaccagcaacaacaaattaattttcatgatatt
ctgaactcaaaatttgttgtgggaccaccttcgccttttgctttagtagcaattgccaaa
tcaattcttgcacggtttgggaatccagaagaagtttctgaaaaagaagatggaagcgaa
gaggaagccggaaccagtggagctgatgaagagggaaagcaatacaaaaatactgatcag
ctggttggagctagtttaacatgtatcttcgaagttctcgagcaattaagtcgacgtgac
gccgaactttgtgttcaagctctcgaatcattgttatcattgatccaatcgatgccaatc
gattgtcttcagtccgaaaaccgtttatcaatgtctgcaatgatgcacgttctgaaaacg
cttcgagaagatgcctgtccctcagtgagctcaaaagctacctcatgccttgtggcttta
tcagttgcatgtggagagccggagcatttaggaagcacaattcgatcattaatttgtatg
aagaaaaatattcgaatgagcgccgattcgacgtatgatatgatccaaatgccagaaaat
ttgagaaaattactactgaaagtgaggaggaaagctttaggcggagacaacactgccaat
tccccaccaaactgggcaatggtagatgttcacgagcactcggtagcaagcagtttcagt
ctacctagtcttcctgatagctctccgtcttccgacactcccgacgatgacaatcgaata
catagcacaatggcatgtgatggaacatttctctacattcttaattatgttggactctac
aagttggggaccggcctgaatgaaacaatttctggaaagttgtatgcagcgaatcagagt
ttacaatcgtcgaaaaatgtgcaaatgtatttatgcaatggatcattgtatttacgaaga
aattactcatcatgcatatcagtgattgacacggattcattgttggatattggagaagtg
attctaccaccaagttgtgtacaacatgcactgttcacggatggaacatacttttacagt
gcaactctgattgccaattctacactatcgacaattcaactaaatgattcattttcccct
tccaatgagccatcatcacgaagaagtcatcgactcactgatgtgaagttcacgattcaa
ggagatcttcaagttcctcaccaactccccgaatttctacctgcaaaccttcatcctcaa
actgttgatcttcacttcactcgagaaatggcattcattcaagctcgctctggaaaagtg
tactacgctggaaacgggacaaggttcggattatttgaaactgggaacaactggatggaa
ctgtgtcttcccgagccaatagttcaaatttctgttggaattgatacaataatgtttcgt
tctggtgcagggcatggttggattgcaagtgtagacgataagaaaagaaatggaagacta
cgtcgacttgttccatctaatcgccggaaaattgttcatgtttgcgcctctggtcatgtc
tatggatatgtatctgaaaatggaaagattttcatgggaggacttcatacaatgagagtg
aatgtttcaagtcaaatgttaaatggactggataatgtgatgatttcttcattagcgctt
ggaaaatctcacggtgttgctgtgactcgaaatggccatctttttacatggggattgaac
aatatgaatcaatgtggaagagttgaatcaacttcaaccacgtcttctccaagacattcc
ggtcgtcaagagtatcagatttgtcctatcggagaacacacgtggctaactgacacaccc
tcggtatgtgctcaatgcgggctttgctccgcacgaggagtagcatgtggaagagttcct
cgaccaaagggaaccatgtgtcattgcggtgttggagagtcaacatgccttcgatgtgga
ctttgcagaccatgtggagaggttacagaaccagcacagcctggtagagctcagcatgtg
caattcagttcaacagctgctcctcaaagaagtactctacatccgtcacgtgtaatttta
agtcaaggacctcatgatgtaaaagtttcaagcgtaagctgtggaaattttcatacagta
cttcttgcatctgatcgaagagttttcacttttggatccaactgccatggccaattagga
gttggagatacacttagcaaaaacactccgcagcaagtcattcttccatctgatacagtt
atagtccaagttgccgctggttcaaatcacacaattttgagggcaaatgatggaagcgtt
ttcacatttggtgcatttggaaaaggtcagctagcacgaccagctggcgagaaagctgga
tggaatgcgatccctgaaaaagtttctggttttggtcctggattcaatgcattcgctgga
tggatcggagccgatggtgattcttcaatcatccatagtcatacagctttattatcttct
gataatattctgaaagctcaaattgttgcaaacaaaacgaatattttcattttcccaaga
gaagttggtaaagactacattgtaataagacgaaagttgaatgtttttgaacatcatgcg
agcgattacaaatgttggtatacatcatgggccactgatccgaagtatgacatgctgtgg
tattacaattcagcagaaatggaaatcaaaggatatgacattttcaaaaaatctgaaaaa
tctgtgggcgatgcatttgattccctaactttcctagctggtgccgaatttgctgtccaa
gtgtacgacagtcctgcttatgcaacttcgatgagtcttggaatgcaacttttatcagca
acattctcagcaaatgttatcaatttatctgaattctggaaggaaaaacatggggaacga
gaacaggatcacgagaaaacaattatggatggttattcagttgcaaatcgatttgatggt
acgggaggtggttggggatactcggcaaattctgttgaagctatccaatttaaagtctcc
aaggaaattcgattagtaggagttgggctgtatggaggacgaggagaatacatatcgaag
ctcaagttatatcgacaaattggaacagaagctgatgagttatatgtggagcagatcact
gagactgatgaaacagtttatgattgtggagcacatgagactgcaactcttttattctca
caaccaatagttattcaaccaaatcattggcatgtagtcagtgcaaagataagtggtcct
tcttctgattgtggagcaaatggaaaacgtcatgtcgagtgcgatggagtaacatttcag
tttcgaaaatctgctgtgtcaaacaatggaactgacgtagatgttggacagattccggag
ctgtattatcaaattgtcggtggatctgaaagtcgtgacgaatcggattcgaataaacag
ctgtcaatcagtagagacatgtcaaatctcttttcacctgctgcactgaaaaatgtcaca
gcggaaggaattggtaatttgctgatacttttggagtgggctttacaacgcgttcaaatt
gatgaagatacaaacaatcaagttgaaggaagtgctgaaaatcaatggagtcaggaaaga
gcaggatttgttgctattttaagcatgaagcttatatcaagattcgtaagaacagtgtac
aaagagaagggatgtcatgatgaaccaggaattgattttgctaataagttggtaaatctg
cactcaatgctcttagaattcttcttttcaaccgatatgactggatatgaaaatcgtcca
ttaattaaaaaagaagaaaaggttgttgaagaagggtatactctgatgaagtgtgtgtcg
gaagcggttaagctattcatttctctttctcactgctttatgggatcaagaagtctcatg
aatgctcatcttatcgctgtcatgaacaaaggaaatcatgaagctttgatcctaacatct
gcaattattggatcccttgctaaaattgaacggtttgctcatcaacttctatgctcgact
accacaactgaaagatttccaatgctgtcatcacttcttctgaaacatttcaattgtgag
aaagaaacactcgcgtctctcacttcatttccaaatattcttcgatttctttacgatcaa
acttttatgagaaatgcgtacgaaaacacgtcaagtttggctgaggccattttggtcaag
gtatcgagagatcttgccattccgacagatgatactcttatgggaccagtagtacatcaa
acttcgtcgaggttcagaagaagaagtgcacaacctacttgggatatgtctgatggatgt
gcagatgcaattgcttttagagtggactccgaagggataaaattacacggttttggaata
tatcttccaactgaaccagaccgacggaatttcgttggagaaataatgatgttgtctcca
gattcatctgaaaaatggacatgccttcttcgggttactgctgaaatgtcgtctgaagaa
aaagaagttggaattgttagatttccagaatatgtacttctttctccaggtgtcacttac
gctgtcaaagttaacatgatgaaaaatacaaagacattctgcggagaaggtggagtcact
caagtgcatctactcaatggagcccgcttgtttttctcaggatgctcaatgagccaaaat
ggaacaacagttcaacgcggacaactaccatacttgatatattcaatccttgatcaatca
aacagtcttcaaataaaacaagaaacaatttatgatacattcactctacttcttcgattg
atggctaacaaaattggtgccgcaataacagaaggtggagcacttcctgcatgctgtcaa
catttgatgtctcatataaatcctcatgtcatggtatacatggaaagattcccagataaa
gctttagagatgatgtcaacaatggaacagttgatcccaatggtttcaaatttgaacgga
gttgaaagagttttccattcatacgattcagatgacagtggctgtgatacaccatattct
ggaattgtgacaactgtggttgagagtcaacatccatacaaaccaaatacatcaagctca
atggttttgttgttcgaggaagctgattacatttgtgtccgattttcaccggattgtcaa
actgcacaatttgatgatcaactgacaatttatctcaaaatcgatgagcattcttacatg
ccaattgaacgttgttatgggagcgaatggccgtcctatccaatgatattgcctggaaac
tgtctgatgtttgttttggatgcatcttctgctgttgaaggtgcaacttctgaacagatg
ttcggttaccacgtgacagtaaccggatatttagttggttacaatgattctactatgcga
ctggaacaagatctcgtttggttgtcagctaatgcttgtcgaataatgacacaattaccg
atcaatccgagcaacattgaacatttgagcacagctgaagacgacactcgtcatctattt
gagaaacacggaagtcttctgaaaaaaggtcttagcttgagtcattcaccaactctcagt
gagctgtgtacaaagggacaaccacctccagcactaaaacattttacatatacatattca
gaacctcaattttga

DBGET integrated database retrieval system