KEGG   Caenorhabditis elegans (nematode): CELE_C09G12.8
Entry
CELE_C09G12.8     CDS       T00019                                 

Gene name
ced-10
Definition
(RefSeq) Ras-related protein ced-10
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04145  Phagosome
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C09G12.8 (ced-10)
   04310 Wnt signaling pathway
    CELE_C09G12.8 (ced-10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C09G12.8 (ced-10)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C09G12.8 (ced-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_C09G12.8 (ced-10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C09G12.8 (ced-10)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_C09G12.8 (ced-10)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    CELE_C09G12.8 (ced-10)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    CELE_C09G12.8 (ced-10)
  Macropinocytosis
   Ras GTPases
    CELE_C09G12.8 (ced-10)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    CELE_C09G12.8 (ced-10)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C09G12.8 (ced-10)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C09G12.8 (ced-10)
  Exosomal proteins of colorectal cancer cells
   CELE_C09G12.8 (ced-10)
  Exosomal proteins of bladder cancer cells
   CELE_C09G12.8 (ced-10)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    CELE_C09G12.8 (ced-10)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 177111
NCBI-ProteinID: NP_500362
WormBase: WBGene00000424
UniProt: Q03206
LinkDB
Position
IV:complement(join(3507379..3507571,3508509..3508600,3509389..3509493))
AA seq 129 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAG
QEDYDRLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQR
AKKSKCTVL
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcaagcgatcaaatgtgtcgtcgttggtgacggagccgtcggtaaaacgtgtctcctg
atatcctacaccacaaacgcatttcccggagaatatattccgacggtattcgacaactac
tcagcaaatgtgatggtcgacggtcggccgataaatctcgggctctgggatacagctgga
caggaagattacgatcggctccgcgaacgccggctccaaccagtgagccaaacccagggc
tacgtgatggcaaaggaaatcaaggctgtcaagtatctggagtgctcggcgctcacgcaa
cgtggtctgaaacaagttttcgatgaggcgatccgagccgtgctcacgccgccacaaaga
gccaaaaagagcaagtgtacggtgctctaa

KEGG   Caenorhabditis elegans (nematode): CELE_C35C5.4
Entry
CELE_C35C5.4      CDS       T00019                                 

Gene name
mig-2
Definition
(RefSeq) Uncharacterized protein
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04145  Phagosome
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C35C5.4 (mig-2)
   04310 Wnt signaling pathway
    CELE_C35C5.4 (mig-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C35C5.4 (mig-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C35C5.4 (mig-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_C35C5.4 (mig-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C35C5.4 (mig-2)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_C35C5.4 (mig-2)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    CELE_C35C5.4 (mig-2)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    CELE_C35C5.4 (mig-2)
  Macropinocytosis
   Ras GTPases
    CELE_C35C5.4 (mig-2)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    CELE_C35C5.4 (mig-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C35C5.4 (mig-2)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C35C5.4 (mig-2)
  Exosomal proteins of colorectal cancer cells
   CELE_C35C5.4 (mig-2)
  Exosomal proteins of bladder cancer cells
   CELE_C35C5.4 (mig-2)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    CELE_C35C5.4 (mig-2)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA Lipase_GDSL_3
Other DBs
NCBI-GeneID: 181344
NCBI-ProteinID: NP_509931
WormBase: WBGene00003239
Ensembl: WBGene00003239
UniProt: G5EBV3
LinkDB
Position
X:join(11548608..11548726,11548802..11549034,11549554..11549714,11550110..11550184)
AA seq 195 aa
MSSPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMSLDGNVVNLGLW
DTAGQEDYDRLRPLSYPQTDVFILCFSVVSPVSFDNVASKWIPEIRQHCPDAPVILVGTK
LDLRDEAEPMRALQAEGKSPISKTQGMKMAQKIKAVKYLECSALTQQGLTQVFEDAVRSI
LHPKPQKKKKSCNIM
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcttcaccgtcgaggcagatcaaatgtgtagttgttggagacggaacagttggaaaa
acatgcatgttaatatcttacacaactgactcttttccagttcagtatgtgcctacagta
tttgataactattcggcacagatgagtcttgatgggaacgttgtgaacttaggattgtgg
gatactgctggacaggaggattatgatcgtttacgaccactttcctacccacagacggat
gttttcattctctgcttctctgtcgtctcgcccgtatcgtttgacaatgtggcaagcaag
tggattccggaaatacgacagcattgtccagatgcgcctgtcattctagttggtaccaaa
ctcgatttgcgcgacgaggccgaaccgatgcgtgctctgcaggccgaaggaaagtcccca
atttccaaaacgcaaggcatgaaaatggctcaaaaaattaaagctgtcaagtatttggaa
tgctctgcattgacgcaacagggactcacacaggtgttcgaagacgccgtacggtccatt
cttcatccgaaaccacagaaaaagaagaagtcttgcaatattatgtaa

KEGG   Caenorhabditis elegans (nematode): CELE_K03D3.10
Entry
CELE_K03D3.10     CDS       T00019                                 

Gene name
rac-2
Definition
(RefSeq) Ras-related protein rac-2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04145  Phagosome
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_K03D3.10 (rac-2)
   04310 Wnt signaling pathway
    CELE_K03D3.10 (rac-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_K03D3.10 (rac-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_K03D3.10 (rac-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_K03D3.10 (rac-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_K03D3.10 (rac-2)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_K03D3.10 (rac-2)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    CELE_K03D3.10 (rac-2)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    CELE_K03D3.10 (rac-2)
  Macropinocytosis
   Ras GTPases
    CELE_K03D3.10 (rac-2)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    CELE_K03D3.10 (rac-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_K03D3.10 (rac-2)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_K03D3.10 (rac-2)
  Exosomal proteins of colorectal cancer cells
   CELE_K03D3.10 (rac-2)
  Exosomal proteins of bladder cancer cells
   CELE_K03D3.10 (rac-2)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    CELE_K03D3.10 (rac-2)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 186939
NCBI-ProteinID: NP_001040961
WormBase: WBGene00004287
Ensembl: WBGene00004287
UniProt: Q94124
LinkDB
Position
IV:join(16308225..16308329,16308726..16308817,16309257..16309442,16309625..16309829)
AA seq 195 aa
MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAG
QDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLR
EDRDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPP
QTPQTRAKKSNCTVL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcaagcaatcaaatgtgtcgtcgttggtgacggagccgtcggtaagacgtgtctcctg
ctatcgtacactacaaacgcttttcccggagaatatattctaacggtattcgacacctac
tcaacaaatgtgatggtcgacggaaggccaataaatctcagcctatgggacacagctgga
caggacgattacgatcaattccgccacctgtcatttccacaaacagacgtattcctcgta
tgctttgcactgaataatccagcaagttttgagaatgttcgtgcaaaatggtatccagaa
gtatcacatcattgcccaaatacaccgattattttggttggaactaaagctgatttacgc
gaggatcgagatactattgaacggctccgtgaacgtcggctccaaccagtgagccacacc
cagggttacgtgatggcaaaggaaatcaaggcggtcaagtacctggaatgctcggcgctt
acccaaattggattgaaacaagttttcgatgaggcaattcgtactgggctcaccccgcca
caaacaccacaaacgagagccaaaaagagcaattgcacggtgctttaa

DBGET integrated database retrieval system