KEGG   Caenorhabditis elegans (nematode): CELE_C48A7.1
Entry
CELE_C48A7.1      CDS       T00019                                 

Gene name
egl-19
Definition
(RefSeq) Voltage-dependent L-type calcium channel subunit alpha
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04020  Calcium signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C48A7.1 (egl-19)
   04020 Calcium signaling pathway
    CELE_C48A7.1 (egl-19)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C48A7.1 (egl-19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cel04040]
    CELE_C48A7.1 (egl-19)
Ion channels [BR:cel04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   CELE_C48A7.1 (egl-19)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 177513
NCBI-ProteinID: NP_001023079
WormBase: WBGene00001187
Ensembl: WBGene00001187
UniProt: Q8MQA1
LinkDB
Position
IV:join(7405582..7405588,7406131..7406222,7407983..7408146,7408201..7408306,7408830..7408969,7409023..7410029,7410248..7411094,7411184..7411307,7411354..7412756,7413032..7413531,7413706..7413810,7413959..7414095,7414598..7414702,7415858..7415966,7416146..7416401,7416675..7416956,7417660..7417909)
AA seq 1877 aa
MSVLASMMSSGEDEEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRPAQRKPLRQTNV
VERSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKN
TLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMS
IQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGL
ELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWP
GPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVL
NLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQED
EPVAQTVVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVI
LLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRF
DCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSI
ISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNT
VMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEE
QQEIEGEDEEFEEGEDEGEEHGMDEPEGDEEMTSARPRRMSEVPAASTVKPIPKASSLFI
LSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTS
VFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRV
LRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLS
KMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLY
VAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCEL
DKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYP
SSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGK
LNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIY
AVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCD
PMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGP
HHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLN
SDGTVCFNATLFALVRTNLKIYTEGNIDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKE
DDVTVGKFYATFLIQDYFRRFKKRKEMEAKGVLPAQTPQAMALQAGLRTLHEIGPELKRA
ISGNLETDFNFDEPEPQHRRPHSLFNNLVHRLSGAGSKSPTEHERIEKGSTLLPFQPRSF
SPTHSLAGAEGSPVPSQMHRGAPINQSINLPPVNGSARRLPALPPYANHIHDETDDGPRY
RDTGDRAGYDQSSRMVVANRNLPVDPDEEEQWMRSGGPSNRSDRRNPHLREPMLVARGAA
LALAGMSSEAYEGTYRPVGEGKSVRLPFSSRPVLRPAEDSRPVDRLIGQSLGLGRYADAR
IVGAARREIEEAYSLGEQEIDLAADSLAPLMQHVGMHDIRDINENSRSALLRPAENSSRQ
HDSRGGSQEDLLLVTTL
NT seq 5634 nt   +upstreamnt  +downstreamnt
atgtcagtgttagcgagtatgatgtcatcgggggaggacgaggagcaggcggcagctgat
gagcaggagagaaccgatctgtggcagcagacattacaggccgccgtggcagcttcatca
tcacaagatgccacaaagaaacgacccgcacaacggaaacctcttcgacaaacgaacgtc
gtcgaaagatccgaacgatcacttctttgcctctccttgaataatcccatccgaaaattg
tgcatcagtattgttgaatggaaaccattcgagtttttaatattgtttatgatatgtgcc
aactgtatcgctctagccatctatcaaccctatcctgctcaagattcagactataaaaat
acattacttgaaacaattgaatacgtgttcattgtcgtattcacgatagaatgtgtgctc
aaaatagtggctatggggtttatgtttcatcccagtgcatatcttcgaaacgcatggaat
attctcgattttattattgttgtcataggacttgtgagtaccatattatcaaaaatgtca
attcaaggattcgatgtaaaagctttgagagcatttcgtgtacttcgaccgcttcgtctt
gtatcaggagtaccaagtttacaagttgtgctcaacgccatccttcgagccatgattcct
ttgctccacattgccttattggttctgtttgttattttgatctatgctattattggatta
gagttattctgcggaaaacttcattcaacatgtatagatccagcaactggacaattagcg
caaaaagatccaacaccttgtggtactgatacagaaggaagtgcattcaaatgtcaacca
tctgattctttaaccaatatgggtgttcgatgggaatgttcaagtaacacaacatggcct
ggtccaaacaatggaatcacgaactttgataactttggacttgctatgcttacagtattc
caatgtgtatcattagaaggttggacagatgtaatgtactgggtaaatgatgctgttggc
agagagtggccgtggatatattttgtcactcttgtcattcttggatcatttttcgtactc
aatcttgtcttgggagtcttgtctggagaattctcaaaagaacgagaaaaggcaagagcg
agaggattgtttcaaaaatttcgagaaaagcaacaacttgaagaagatttgaaaggatat
ctcgactggatcacacaagcagaagatattgaaccagtgaatgaagatgaacaagaagat
gaaccagttgcacaaactgtagttggagaagaagctgatgaagaaggagaagaacgagtt
gaagatgttagaccgagtaaatgggcagctagaatgaaacgattagaaaaattaaatagg
agatgtcgaagagcttgtagaagattggtcaaaagtcaaacattttattggctggttatt
cttcttgtgttgctcaatacattagtactaacatctgaacattatggacaatccgaatgg
ctcgatcatttccaaacaatggcaaacttgttcttcgtaatccttttctcgatggaaatg
ctcttgaaaatgtattcgcttgggttcacgacttacacgacatctcaatttaatcgattc
gattgtttcgtcgttatcagttcgattttggagtttgtgcttgtctatttcgatcttatg
aagccacttggagtgtctgtgctgcgttcagcacgtcttctgagaatattcaaagttaca
aagtactggacatcacttcgtaatttggtatcttcacttttgaactctcttcgatccatc
atttcccttctgttactgcttttcctgttcattgttatctttgctttattgggaatgcaa
gttttcggaggaaaattcaatttcaatccacaacaaccaaaaccaagagccaatttcgat
acattcgttcaagcattgctaacagtattccaaattcttactggtgaagattggaatact
gtaatgtatcatggaattgaatcatttggaggtgttggaacacttggagtcatcgtctgt
atctactatattgttctgttcatttgcggtaattacattttactgaatgtcttcttggct
attgctgtcgataatttggccgatgcagacagtctgacaaatgcagaaaaagaagaagag
caacaagaaattgaaggtgaagatgaagaatttgaggaaggagaggatgaaggtgaagag
catggaatggatgaaccagaaggagatgaagaaatgacatcagcaagaccgagaagaatg
agtgaagttcctgctgcaagtacggtcaaaccgattccaaaggcttcttcgcttttcatt
ctcagtcataccaactcttttcgagtgttttgcaacatggttgtcaatcattcatatttc
accaacgccgttcttttttgtattttggtatcatctgctatgttagctgctgaagatcct
ctacaagcaaactcaactagaaatatgattctgaattactttgactacttcttcacgtct
gtgttcacagttgagatcacgttgaaagtcatcgtatttggtttggtattccacaaagga
tcattctgtcgaaatgcattcaatcttctcgatatcctcgtcgttgcagtatcattaaca
tcttttgtacttcgaactgatgcaatgtctgtcgtcaagattcttcgtgtgctccgtgtg
ctccgtccacttcgtgcaattaaccgagccaagggtttgaaacatgttgtacaatgtgta
attgttgctgtaaagactatcggaaatatcatgttggtcacattcatgcttcaattcatg
tttgcaattatcggagttcaacttttcaagggaacattcttcctttgcaatgatctttcg
aaaatgacagaagcagaatgccgtggagaatatattcattatgaagatggagatccaaca
aaaccagtttcaaagaaaagagtttggtcgaataatgacttcaattttgataacgtcgga
gatgcgatgatttcacttttcgtagtttcaactttcgaaggatggccacaacttctttat
gttgcaattgattcaaatgaagaagataagggacctatacataattcaagacaagctgtt
gctttgttcttcattgctttcatcattgtcatcgcattcttcatgatgaacatcttcgta
ggtttcgttatcgttacattccaaaatgaaggagaacgtgaatacgagaattgtgaattg
gacaagaatcaaagaaaatgtattgaatttgcattgaaagctaaaccacacagaagatac
attccacgaaacagattacaatacagagtttggtggtttgtcacatcaagagcttttgag
tatgtcatctttctgattatcgtcatgaatacagtatctttggcgtgcaagcattatcca
agttcgagaggattcgaagactttttggatgtgttcaatttgattttcactggagttttc
gcatttgaagctgttctgaagattgttgcattgaatccgaaaaattatatttccgatcga
tggaatgtctttgatttgttggttgttgtcggatcatttattgatatcacatatggaaaa
ttgaatccaggaggaacaaatcttatttcaatcaactttttccgtctgttccgtgtgatg
cgtctcgtgaagctgctttcaagaggagaaggaattcgaacacttttatggacattcatg
aaatcatttcaagctcttccatacgtcgccttgctcatcgttttgctctttttcatttat
gctgtcatcggaatgcaattctttggaaaagttgcactggacgattcaacatctatacac
aggaacaataacttccattcgttccctgcagcgattttggtgttattcagatcagcaact
ggagaagcctggcaagatatcatgctttcgtgttcggatcgagaagatgtcagatgtgat
ccaatgtctgatgattaccataaaggaggcctcaacgaatctagatgtggaaacaatttt
gcatatccatacttcatttcattcttcatgctttgctctttccttgtcatcaatcttttc
gtagctgttatcatggacaatttcgattatttaacaagagattggtcaattcttgggcca
catcatttggaagaatttgtaagattatggtctgaatatgatccagatgcaaaaggacga
attaaacatcttgacgtcgtcacacttcttcgaaaaatctctcctccacttggatttgga
aaactgtgtcctcatcgattggcctgtaagagattggtatcaatgaatatgcccttgaac
tcggatggtactgtatgcttcaatgcaactctttttgctctcgttcgtaccaatttgaag
atttatactgaaggaaacatcgacgaagcaaatgaacagctgcgatcagcaattaaacga
atttggaaacgaactcataaggatttgttggatgaggttgttccaccggcaggaaaagaa
gatgatgtgaccgttggaaaattctatgccaccttcctcattcaagactatttccgtcgt
ttcaagaagcgaaaagagatggaagcaaagggtgtcttaccagctcaaacacctcaagcg
atggctcttcaggccggactccgcacgctacacgagatcggaccagaattgaaaagagcg
atttctggaaacttggagaccgacttcaactttgacgaaccagagcctcaacacagaaga
ccacactctcttttcaacaatttggtacatcgtctatctggtgccggatccaaatctcct
actgaacacgaacgtatagaaaagggctctacacttttgccattccaaccacgctctttc
tctccaactcattcacttgctggcgctgaaggatcaccagtaccatcacaaatgcatcgt
ggagctccaatcaatcaatcaataaatcttccacctgtcaatggatcagctcgacgtctt
cccgcccttccgccgtacgcaaatcatattcacgatgagacggacgacggccccaggtat
cgggatactggcgatcgagctggttacgatcaatcaagcagaatggttgttgccaataga
aatctgcctgttgatcccgatgaagaagagcaatggatgagaagtggtggaccgtcaaat
cgatctgacagacgaaacccacatctacgagaaccgatgcttgttgctcggggagccgct
cttgcactcgctggaatgtcatcagaagcctacgaaggtacttataggccggttggagaa
ggaaagtctgttcgacttccattctcatctcgacctgttctccgacctgccgaagattca
cgacctgttgatcgactgatcgggcaatcattaggacttggaaggtacgccgacgctcgg
attgtcggagccgctcgacgagaaattgaggaagcatattcacttggtgaacaggaaatt
gacttggcagcagactcattagctccattaatgcaacatgttggaatgcatgatatcaga
gatatcaatgaaaactctcgaagcgcacttttacgacccgccgaaaattcatctcggcag
catgattcacgcggaggatcacaagaagatctacttttagttacaactctttga

DBGET integrated database retrieval system