KEGG   Caenorhabditis elegans (nematode): CELE_DY3.7
Entry
CELE_DY3.7        CDS       T00019                                 

Gene name
sup-17
Definition
(RefSeq) Disintegrin and metalloproteinase domain-containing protein 10 homolog
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_DY3.7 (sup-17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_DY3.7 (sup-17)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cel04090]
    CELE_DY3.7 (sup-17)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     CELE_DY3.7 (sup-17)
Peptidases and inhibitors [BR:cel01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   CELE_DY3.7 (sup-17)
CD molecules [BR:cel04090]
 Proteins
  CELE_DY3.7 (sup-17)
SSDB
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Disintegrin Reprolysin_4 Pep_M12B_propep Reprolysin Peptidase_M43
Other DBs
NCBI-GeneID: 172689
NCBI-ProteinID: NP_492377
WormBase: WBGene00006324
Ensembl: WBGene00006324
UniProt: G5EFD9
LinkDB
Position
I:join(8793098..8793238,8793290..8793372,8793416..8793540,8793585..8793646,8793715..8793845,8794134..8794515,8794573..8794641,8794691..8794826,8794878..8795069,8795146..8795594,8795639..8795858,8795906..8796144,8796224..8796379,8796427..8796810)
AA seq 922 aa
MSSPIRNRLQLVVTLIFCLFFENVNGLNNFIDNFETLNYRATHVANQVTRRKRSIDSAAS
HYQEPIGFRFNAYNRTFHVQLHPIDDSLFHEDHMSDVDGGYADIKPSHFLYEGYLKDDPN
SHVHGSVFDGVFEGHIQTGEGRRYSIDKAAKYFERDDRPTQYHSIIYRDDEINHRKWRVK
RDAENLSEQMQGCGFSSRVRREMTDVQNSGESTDFFTNYMTMGGRSKRANTLRDHDGLYF
VRTCSLYMQADHKLYEHIRMKEGNNDPIRTREEIVSLFYNHIKAVNEIYEGTNFNGIKGL
HFVIQRTSIYTPDSCDRGRAKTDSDNPFCEENVDVSNFLNLNSQRNHSAFCLAYALTFRD
FVGGTLGLAWVASPQFNTAGGICQVHQRYNEGSRGWVYRSLNTGIVTLVNYGNRVPARVS
QLTLAHEIGHNFGSPHDFPAECQPGLPDGNFIMFASATSGDKPNNGKFSPCSVKNISAVL
AVVLKSMPVDPTRNASPVGIGKRNCFQERTSAFCGNQIYEPGEECDCGFSQADCDQMGDK
CCVPHEARGNGGPGPCKRKPGAQCSPSQGYCCNPDTCSLHGKNEEKICRQESECSNLQTC
DGRNAQCPVSPPKHDGIPCQDSTKVCSSGQCNGSVCAMFGLEDCFLTEGKADELCFLACI
KDGKCTSSVHLPEFSANRTNFLQNMRKDKPGLILHPGSPCNNYKGYCDIFRKCRSVDANG
PLARLKNLLFNKRTIETLTQWAQDNWWVVGVGGLVFLVIMALFVKCCAVHTPSTNPNKPP
ALNIYQTLTRPGTLIRQHRQRHRAAAGSVPPGPGAQPRSGAASAPSRTTPSARPSAPPLV
APQVAVAVPPGVVGPPIPLIATHPGSSSSTPAVIVLEPPPPYTAADPGSAMGGPRRGHRK
NKRQTSSDAAGSSGNGGKKKGK
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgagcagtccgatacgaaatcgactgcagctcgtcgtcacactcatattttgtcttttc
ttcgaaaatgtaaacggattgaataatttcatcgataattttgagactttgaactatcgt
gccacgcatgttgcaaatcaggtaacacgacgaaaacgatcgatcgattcagcagcttct
cattatcaagaaccaattggtttccgattcaatgcatacaatcgaacattccacgttcaa
ttgcacccaatcgatgactcattgttccatgaggatcacatgtcagatgttgatggtgga
tacgctgatatcaagccaagtcattttttatatgaaggatatttgaaagacgatccgaat
tcccatgtgcacggaagtgtatttgatggagtctttgaaggacatattcagaccggtgaa
ggacggagatattcgattgacaaagcggcaaaatactttgaaagagatgaccgacccact
cagtatcactcgattatatacagagacgatgagattaatcatcgaaaatggagagtgaaa
agagatgccgaaaacctatccgaacaaatgcaaggatgtggtttctcatctcgtgttcgc
cgtgaaatgaccgatgttcagaattctggagaaagcaccgatttcttcacgaattacatg
actatgggcggtcgatcgaaacgagcaaatactcttcgagaccacgatggactttatttt
gtgagaacatgctcattatacatgcaagctgatcataaactttacgaacatattcgtatg
aaagaaggaaataatgatccgattcgaacgagagaggagattgttagcttgttttataat
catatcaaggctgtaaatgagatttatgaaggaacgaattttaatggaatcaagggactt
cattttgtcattcagagaacctcgatctacacccctgatagctgtgatcgtggaagagcc
aagacagattctgataatccattctgtgaagagaacgttgacgtttccaatttcttgaat
ttaaattctcaacgaaatcattcagcattttgtctcgcctatgctctcacattcagagat
tttgtcggtggaactcttggtcttgcctgggttgcgagcccacaatttaacacagctgga
ggaatctgccaagtacatcagagatacaatgaaggaagtcgtggatgggtttatagatcg
cttaacactggaattgttactctcgttaattatggaaaccgagtaccagcgagagtttca
caattgactctggctcacgagattggacacaatttcggatcgcctcatgattttcctgct
gagtgtcaacctggtcttcctgatggtaacttcattatgtttgcatctgcaacatcagga
gacaaaccgaacaatgggaaattctctccttgctctgtcaaaaatatctctgcagttctt
gccgttgtactcaaatcaatgccagtcgatccaacacgcaacgcatctcctgttggaatc
ggaaagagaaattgcttccaggagagaacttctgcattctgtggaaatcaaatctacgaa
cccggagaggaatgtgattgtggattctctcaagctgattgcgatcaaatgggtgataag
tgttgtgttccacatgaagcacgtggaaatggtggtccaggaccctgcaaaagaaaacca
ggagcacaatgctctccatctcagggatactgctgtaatccagatacatgctctctgcat
ggtaaaaacgaagagaaaatatgcagacaggaatctgaatgttcaaaccttcaaacttgt
gatggaagaaatgcacaatgcccagtctctccaccaaaacacgatggaattccatgtcaa
gacagtacaaaagtttgctcgagtggacaatgtaatggatcagtttgtgcaatgtttgga
ctggaagactgtttccttaccgagggaaaagctgatgagctatgcttcttggcgtgtatt
aaagatggaaagtgtacatcatctgtccatcttccggaattctctgccaatcgtaccaat
ttcttgcaaaatatgagaaaagacaaacctggactcattcttcatcctggatcaccgtgt
aataactacaagggatattgtgatatcttcagaaaatgccgaagtgttgatgcaaatgga
ccattggcacggctgaagaacttgctgttcaacaagagaacaatcgaaactctaacacaa
tgggcacaggataactggtgggttgtaggagttggcggtctcgtattccttgtgattatg
gctttgttcgtgaagtgttgcgctgtacacacgcctagtacaaaccccaacaagccaccg
gcacttaacatctaccagacactcactcgtcctggaacattgattcgtcaacatcgccaa
cgtcatcgtgcagctgctggtagtgttccaccaggaccaggtgcccaaccgcgttccggt
gcagcttctgcaccatctcgaacaacaccttctgcacgtccatctgcccctccattggta
gctccacaagtcgctgttgccgttccacctggtgtcgttgggcctccaattccactgatt
gctactcatccaggatcttcaagttcaacacctgcagtcattgtcctcgagcctccacca
ccgtatacagctgctgatcctggatcagcgatgggcggaccacgaagaggtcacaggaag
aataagagacaaacttcttcagatgctgctggttcttcagggaatggtggcaaaaagaag
ggaaagtaa

DBGET integrated database retrieval system