KEGG   Caenorhabditis elegans (nematode): CELE_F17C8.1
Entry
CELE_F17C8.1      CDS       T00019                                 

Gene name
acy-1
Definition
(RefSeq) Adenylyl CYclase
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00230  Purine metabolism
cel01100  Metabolic pathways
cel04020  Calcium signaling pathway
cel04213  Longevity regulating pathway - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CELE_F17C8.1 (acy-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    CELE_F17C8.1 (acy-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F17C8.1 (acy-1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CELE_F17C8.1 (acy-1)
Enzymes [BR:cel01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     CELE_F17C8.1 (acy-1)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 USP8_interact
Other DBs
NCBI-GeneID: 175622
NCBI-ProteinID: NP_497970
WormBase: WBGene00000068
Ensembl: WBGene00000068
UniProt: Q19523
LinkDB
Position
III:join(4722212..4722496,4724697..4724770,4724880..4725003,4725459..4725761,4726309..4726405,4726453..4726668,4726719..4727074,4727422..4728280,4728530..4728999,4729044..4729229,4729469..4729979,4730076..4730293,4730502..4730564)
AA seq 1253 aa
MDDDVGERTPALGGSCGPSVRAHSSSPRRVPLFERASARWWNPQFRSATLEAQYWKCSFS
QLRDRFRSGLIYIAVVIAAWTLYLALFDRTFIQHWIVSLCLCAIIFAMFAFTACAAQYQR
FYMPTSFLCTFLICLVTLLIFSAENQAAFMTPVASLATSFQVVLLIYTVIPLPLYLCILI
GIIYSILFEILNKNKIGLEEAGYIKLVLHAGVHLLGVHLFILTQVRQRKTFLKVGQSMLA
RKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQVDQPLAKM
VPEYRKFRPFTMNLMTNVSILFADIAGFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGL
EKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQFDIDRGQEVNMRVGIHTGKV
MCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGPL
RMQVQGTERRVKPESMKTFFIKGRINDGVEEEVMQVQEVESLHSQKSSKKSTLKQKWAEK
LKMNHTNSYPMRAAAREGGGSLRIKLAERNRSTQLLPKESNSICIMEDNRKSASLQALAT
NNFNGSNTDTNNTYSERGVAGSVSKKSVAGSESNSIKGSRSSGLQLSLQDGNSDLNSVGG
LDTAISHHHNAASLTRFDTDNNFDQRLAMVIGQGEGGFDKGFWNHHDSLNKWTLRFNEKD
VEEEYRAHFVDSSERYTASKKGHVERHKDLMEQGGEKDGITGSTVNKYRYSGVFIDIIVA
TLIFVISGAVAIMSVRPFPLSLIAYFPFAAAILILTIVLIGLPLLARKKSFQCANQWMPR
HLIGLLLIFLPIGVAICIMPLCQSGDCANVILNYRLAFSYVTILAIFAHCNFSQLAAWPK
TTAAVFIGLLHIAGVFYCEFNLKHLVEEQDTCNVTAIMIPPIRKGLNYTIALNSTSARTL
SQDFGSPLFIWELLLDVILSIVLVAFLNYQFETAFRMSFFGDVQARRDTERMQIVRDQAD
WLLNNVIPAHAVESLKTDTKYSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVI
GDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEHLYQMVDFALAVQHVL
SVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVS
QHTREYLLDRYEFEFRDHIEVKGIDGGMDTYLLVGRKGDGIPPSIKDNQEDEF
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggacgacgatgtcggtgaacgaacaccggctctcggtggttcatgtggaccatcagtt
cgtgcacacagtagttccccaagacgtgttccattatttgagagagcatctgctagatgg
tggaatcctcaatttcgatctgcaacactagaagctcaatattggaagtgtagtttcagt
cagttaagagatcgatttcgttctggattaatatatattgccgttgtaattgccgcttgg
acactttatttagctttattcgatagaacttttattcagcattggatcgtttcactatgc
ctctgtgccattattttcgcgatgtttgccttcacggcgtgcgccgctcaataccaaagg
ttctacatgccaacctcatttctatgcacttttttgatatgccttgtcacgttgctcatc
ttctccgcagagaatcaagctgcgtttatgactccagttgcaagtcttgccacaagtttt
caggtcgttctcctgatctacacagtcattccactgccactctatttatgtatactcatc
ggaataatctactcaatcctatttgagattctcaacaagaacaaaattggtcttgaagag
gccggatacattaagcttgtccttcacgctggtgtccatttactcggtgtccatttgttc
attttaactcaagtgcgacagaggaaaacgtttctgaaagtgggacaatcgatgttggca
agaaaggatctagagttggagacacagtttaaagatcatatgattcagtctgtgatgcct
aaaaaggtagctgatgaattactgaaagatgcatcagaacttcgccgaccttctgcttcc
aacgactcaaactgccgaacttcaaatgctacacaagttgaccagccccttgccaagatg
gtacctgaataccgaaagttccgtccatttacgatgaatctcatgacaaatgtgtcgatt
ctgtttgcggatattgctgggtttactaaaatgtcatcaaataaatctgccgacgaactt
gtcaatctgctcaatgatctttttggaagattcgatactttgtgtcgattgagaggatta
gagaagatttcaactttgggagattgttactattgtgttgctggatgtcctgaaccatgt
gatgatcatgcatgcagaacagtcgaaatgggtctcgacatgattgttgcaatccgccaa
tttgatattgatcgtggacaagaagtgaatatgcgtgtgggaattcatacaggaaaagta
atgtgcggaatggttggaacaaaaagattcaaattcgatgtgttctcaaacgatgtcaca
ctggcaaatgagatggaatcttctggtgttgctggaagagttcacgtttccgaagcaact
gcaaaacttttgaaagggctttatgaaattgaagagggaccggattatgatggtccattg
aggatgcaagttcagggaactgaacgtcgtgttaaaccagaaagcatgaagactttcttt
atcaaaggacgtattaatgatggtgtagaagaagaagtgatgcaagttcaggaagttgag
agccttcacagtcagaaaagcagtaaaaagtcgactctaaaacagaaatgggcggaaaag
ttgaaaatgaaccacacaaattcttatccaatgcgagccgctgcacgtgaaggaggtgga
agtttgagaataaaattggcagagagaaatagaagtacacagttactgccaaaagaatca
aattcaatttgtataatggaagataaccgaaagtcagcatcacttcaagcattggcaacg
aataattttaatggaagtaatacagatacaaataacacttatagtgaacgtggagttgct
ggaagtgttagtaagaagtctgtagctggaagtgaaagtaatagtataaaaggaagtaga
agcagtggactacaattatctctacaagatggaaattctgatttaaattcagttggaggt
ttggatactgcaatcagtcaccatcacaatgcagcatctctcactcgatttgatactgat
aacaattttgatcagcgtttggcaatggtaattggacaaggagaaggaggatttgataaa
ggattttggaatcatcatgatagtttgaataagtggactcttcgatttaatgaaaaggac
gttgaagaggaatatcgagctcattttgtggattcatcggaaagatatacggcatcaaag
aaaggtcatgttgaaagacataaagatttgatggaacaaggtggagaaaaagatggaatt
actggatcaacggtcaacaagtatagatattcaggagtcttcatcgatataattgttgcc
acgttgatatttgtaatatcgggtgcagttgcaattatgtctgtccgtccattcccatta
tcactcattgcatacttcccatttgctgctgcaattctcattcttacaattgtccttatt
ggtcttccacttctcgcccgtaaaaaatcattccaatgtgcaaatcaatggatgccacgt
catctcatcggtcttcttctgatctttcttccaatcggtgtcgcaatctgtatcatgcca
ttgtgccaaagtggagactgtgcaaatgtaattctgaactaccgtcttgcattcagttat
gtcaccattcttgccatattcgctcattgcaacttctcccaattagctgcctggccaaaa
actactgctgcagtatttatcggacttctccacattgctggagttttctactgcgaattc
aatttgaaacacttagttgaagagcaagacacctgcaacgtgacagcaatcatgattcca
ccaattcgcaaaggtctgaactacacaattgcattgaactcgacatctgcaagaacatta
tctcaagattttggatctccattattcatttgggagctgcttctggatgtgatcctgtcg
attgttctagttgcattccttaattatcagttcgaaaccgcattccgtatgtcattcttt
ggagatgttcaagctcgtcgggacactgaaagaatgcaaatcgtgcgtgatcaagccgat
tggctcctgaataacgtgatcccagcccacgcagtagaaagtcttaaaacggataccaaa
tacagtgaaaaccatgaaacagttggtgtactgttcgcttcaatcactaattggaatgat
atgtatgaagagaatttcgaagggggcagagaattcttgagagttctcaatgaagttatt
ggtgactttgatgagcttctcgatcggccggacttcacgcatattgaaaaaatcaaaaca
attgggcctgcgtatatggcagcaagtggattgaatccagaacgaaaaaagaatatgttg
catccaaaagagcatctatatcagatggttgattttgcattggcagttcaacatgtactc
agtgttttcaacgaggatttgctcaattttgattttgtttgcaagttaggacttaatatt
ggacccgtcactgctggtgtcattggaacaacaaagttgtactacgatatctggggtgac
actgtaaacattgctagccgaatgtacagcaccggagttttaaatcgcattcaagtatca
caacacacacgagaatatctcctggatcggtatgaattcgagttccgcgatcatattgaa
gtcaagggaattgatggaggaatggatacttatcttttggttggtcgaaaaggtgatgga
atacctccatcaatcaaggataaccaagaagacgaattttaa

DBGET integrated database retrieval system