KEGG   Caenorhabditis elegans (nematode): CELE_F42G10.2
Entry
CELE_F42G10.2     CDS       T00019                                 

Gene name
mkk-4
Definition
(RefSeq) MAP kinase kinase mkk-4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G10.2 (mkk-4)
   04012 ErbB signaling pathway
    CELE_F42G10.2 (mkk-4)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F42G10.2 (mkk-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F42G10.2 (mkk-4)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_F42G10.2 (mkk-4)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE7 family
   CELE_F42G10.2 (mkk-4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 MIR APH
Other DBs
NCBI-GeneID: 185682
NCBI-ProteinID: NP_509682
WormBase: WBGene00003368
Ensembl: WBGene00003368
UniProt: Q20347
LinkDB
Position
X:join(10027861..10027985,10028039..10028198,10028243..10028365,10028479..10028598,10028645..10028824,10029077..10029145,10029190..10029255,10029306..10029391,10029446..10029511,10029561..10029657)
AA seq 363 aa
MVQEDDENLRNSMSLRPTSLSTRPTSLSVNGNEKTLPEESVLRSLSTGTLKYPDDEHLYT
FSSANLQDLGAIGNGNFGTVYKMRHKETGKLIAVKRIRCNNIGHREQIRLLREHDTIVKS
EKGPNIVKFYGAIFSEGDCWICMELMDISMDLLYKRVYMVKNSRLNENVVGHITVCTVDA
LDYLKKELKIIHRDVKPSNILVDGTGAVKLCDFGICGQLEESFAKTHDAGCQPYLAPERI
TSSDKYDVRSDVWSLGITLYEIATGKFPYQEWNSLFDQIATVVSGDPPILHPDSDDFHYS
LPLVKFINTCLTKDRRHRPKYDTLKSFDFYRIYAVAGPEIEEAKRILGVEAIDTRNHPVD
HRG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggttcaagaagatgacgagaatttacgcaattcaatgtcccttcggccgacttcgttg
tcaacacgtcccacatcactttcggtaaacggaaatgagaagacgcttccagaagaaagt
gtgttacgttctctttcgacaggcacattaaaataccctgatgacgaacatttatacaca
ttcagctccgctaatttacaagatcttggagcaattggaaacggcaattttggaacagtt
tacaaaatgcgtcacaaagaaactggaaaactgatagctgtgaagaggatacgatgcaac
aacattggacatagagaacaaatccgcttacttcgagagcacgacacaattgtgaaatcc
gagaaaggaccaaatatcgtgaagttttacggagcgattttcagcgagggtgattgctgg
atttgcatggaactgatggacatttcgatggaccttctttataaacgagtatatatggtg
aaaaatagtcggctgaatgaaaatgtcgtcggacatatcacagtttgcactgtagatgca
ttggattatttgaagaaagaattaaaaattattcatcgagacgtgaaaccctccaatatt
cttgtagacggaactggagcagtgaaactttgcgattttggtatttgtgggcagttagaa
gaatcatttgcgaaaactcatgacgccggttgtcagccgtatcttgcacccgaaaggatt
acaagttcagacaaatatgatgtgagatcggatgtgtggtcattgggaataactttgtac
gaaatagcaacaggaaaatttccctaccaagaatggaattcactttttgatcagattgct
acagtagtaagcggtgatcctccaattctacatccagacagcgacgatttccattacagt
ttgccgcttgtcaagtttatcaatacttgcttaactaaagacagacgccatcggcccaaa
tatgatactctgaagagttttgacttttatagaatatacgcagttgccggacccgaaatt
gaagaggctaagcgaattcttggagttgaagcaattgacacaagaaatcatcctgtcgac
cacagaggatag

KEGG   Caenorhabditis elegans (nematode): CELE_VZC374L.1
Entry
CELE_VZC374L.1    CDS       T00019                                 

Gene name
sek-6
Definition
(RefSeq) Protein kinase domain-containing protein
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_VZC374L.1 (sek-6)
   04012 ErbB signaling pathway
    CELE_VZC374L.1 (sek-6)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_VZC374L.1 (sek-6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_VZC374L.1 (sek-6)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_VZC374L.1 (sek-6)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE7 family
   CELE_VZC374L.1 (sek-6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 189074
NCBI-ProteinID: NP_509683
WormBase: WBGene00012162
Ensembl: WBGene00012162
UniProt: O01706
LinkDB
Position
X:join(10031152..10031270,10031364..10031523,10031571..10031687,10031851..10031970,10032023..10032202,10032247..10032315,10032367..10032432,10032481..10032566,10032612..10032677,10032897..10032993)
AA seq 359 aa
MDHGDDQDFPMFARPVFLANRPTLESLSSNDGSVAEENPLRSMSTGILKFPDDAHLYPFN
HTNLRHLSQVGAGYYGTVHKMQHNESGRLIAVKKIRYNNICDQTRLLKEHDTHMKSENVP
NIVKFFGACFSEGDCWICMELMDISIDFLYKRVYSVKKSRLNENIIGHITVCIVDALDYL
KRKLNRIHRDVKPSNILINAAGDVKLCDFGICGDLVGSYAITVEAGCVQYLAPERIENMD
KYDIRSDVWSLGITLYEIATGVYPYRGWSNQMEHIEIVVNGDSPILLQNMHNLHYTDPLC
RFINTCLRKNKDDRPKYVNLKTFSFYKMYAVGGPDIEEAKRILGLEAIDARDHPVEQRA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggaccacggcgatgaccaagattttcccatgttcgctcgtccagtgtttttggccaat
cgaccaactcttgaatctcttagcagtaacgacggatctgttgcggaagaaaatccattg
cgttctatgtcaactggcatactaaagtttcctgacgacgcccatctttatccgttcaat
cacacaaatttacgtcatctgagccaagttggagctggatattacggaactgtgcataaa
atgcaacacaacgaaagtggaagacttatcgccgttaagaaaatacgatacaacaacatt
tgcgaccagactcgtctgctcaaagaacacgacacccacatgaagtccgagaatgttcca
aacattgtaaagttttttggagcatgcttcagtgagggtgattgctggatttgtatggaa
ctgatggacatttcgatagactttctttacaaacgggtatactcggtgaaaaaaagtcgg
ctgaatgaaaacatcattgggcatattacagtttgtattgtagacgctttggattacctc
aaaagaaaactcaacagaattcatcgcgatgtgaaaccatcaaacattctgatcaatgca
gctggtgatgtaaaactttgcgattttggaatatgcggagatcttgttggatcctatgca
ataactgttgaagctggctgtgttcaatatctcgcgccggaacgaatcgaaaatatggac
aagtatgatataagatctgacgtttggtcgttaggaattaccttgtacgaaatcgcaact
ggagtgtatccttacagaggttggagtaatcaaatggaacatattgaaattgttgtaaac
ggagattctccaatacttctacaaaatatgcacaacctgcactatacggatccactttgc
cgattcataaacacctgtttgagaaaaaataaggatgatagacccaaatatgttaacttg
aaaacattctccttctacaaaatgtacgcagtcggaggtcctgatattgaagaagcgaag
aggattcttgggcttgaagccattgatgcacgggaccacccagtcgagcagagagcttga

KEGG   Caenorhabditis elegans (nematode): CELE_ZC449.3
Entry
CELE_ZC449.3      CDS       T00019                                 

Gene name
sek-3
Definition
(RefSeq) Protein kinase domain-containing protein
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_ZC449.3 (sek-3)
   04012 ErbB signaling pathway
    CELE_ZC449.3 (sek-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZC449.3 (sek-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_ZC449.3 (sek-3)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_ZC449.3 (sek-3)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE7 family
   CELE_ZC449.3 (sek-3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 180773
NCBI-ProteinID: NP_741776
WormBase: WBGene00022613
Ensembl: WBGene00022613
UniProt: Q8MPS3
LinkDB
Position
X:join(5018018..5018040,5018395..5018454,5018597..5018660,5018716..5018819,5018875..5019043,5019090..5019227,5019277..5019396,5019511..5019562,5019619..5019746,5020227..5020447,5020501..5020657)
AA seq 411 aa
MDPPKKRKASPQNVVKSSACKQSGVRQSTSSRKRQLQQPAMPDANGHTYAFAPPRNRHNL
AKLNLSGMRNPEPDLTNEDNMNSLDYVKKYLSNTLVLPPNDRIHEFERDHLQELELLGNG
SFGVVRKMLHRPSNVEMAVKQISLINNGPDDAFNKSMQRFRLEVEATKAASNCDEIVRYY
GITFNEGVAWMCMELMDLSLDKLYMIAHDIQKVEIPEQILGAVAVATIRALEHLKTTHHI
IHRDIKPSNILLDRHGCVKLCDFGICGYLQNSVAQSVDVGCRPYMAPERLAPNGDGYDIK
SEVWSLGITMVEVANGKYPYDGFMDAPILDQVRMVVYGDPPILDSDHEVSMSMKRFIALC
TIKDRNLRASFDDLKKTNIYRDYIQEEHRVTVGQFVLKMYQHRLRLPFAIF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggatccgccaaaaaaacgaaaggcaagtccgcagaatgtcgtcaagtcgagtgcatgc
aaacagagtggcgtcagacagagtacgtcttctcgaaaacggcagctacaacaaccggct
atgccggacgcaaacgggcatacttatgccttcgcgccgccaagaaatcgacacaatctg
gcaaagctaaacttgagcggcatgagaaatccagagccagatttgacaaatgaagataat
atgaatagcttagattatgtgaagaaatatctatcaaacactcttgtcctcccaccaaac
gatagaattcacgagtttgaaagagatcacttgcaagagctggaactattgggtaatggc
agttttggagtggttcgaaagatgcttcacaggccgtctaacgtagaaatggcagttaaa
caaatctcccttatcaacaacggcccggacgacgcgttcaataaatcgatgcaaaggttc
cgactggaagttgaagcaacaaaagcggccagcaactgtgatgagattgttcgatactac
ggaatcaccttcaatgagggtgtcgcctggatgtgcatggagctgatggacttgtcgctc
gataaattgtacatgattgcacatgatattcagaaggttgagattccagaacagatcctc
ggagcagtggcagttgcgaccattcgagcactggagcatctgaaaaccacacaccacatc
atacatcgagacatcaagccatcgaatattctgctggacagacatggctgtgtcaagttg
tgcgatttcggtatctgcggctatcttcaaaactcagttgctcagtctgttgatgtcggc
tgccgtccgtacatggctcctgagcgtcttgcacccaatggcgatggatacgacataaaa
tctgaagtatggagtttggggatcactatggtcgaagtggccaatggcaaatacccatat
gatggtttcatggatgctccaatactcgatcaagttcgaatggttgtttatggagaccct
ccaattttggattcagatcacgaagtttcgatgtcgatgaaacggtttattgcgttgtgc
actataaaagatcgcaaccttcgagcaagctttgacgatctgaagaaaacaaacatctac
agagactacatccaagaagagcatcgtgttactgttggccaatttgtattaaaaatgtat
caacaccgtcttcgtcttccgtttgctatcttttaa

DBGET integrated database retrieval system