KEGG   Caenorhabditis elegans (nematode): CELE_F48F7.1
Entry
CELE_F48F7.1      CDS       T00019                                 

Gene name
alg-1
Definition
(RefSeq) Protein argonaute
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F48F7.1 (alg-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_F48F7.1 (alg-1)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_F48F7.1 (alg-1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CELE_F48F7.1 (alg-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    CELE_F48F7.1 (alg-1)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     CELE_F48F7.1 (alg-1)
   microRNA pathway
    RISC loading complex
     CELE_F48F7.1 (alg-1)
SSDB
Motif
Pfam: Piwi ArgoMid ArgoN PAZ ArgoL1 ArgoL2
Other DBs
NCBI-GeneID: 181504
NCBI-ProteinID: NP_001367206
WormBase: WBGene00000105
Ensembl: WBGene00000105
LinkDB
Position
X:join(13949489..13949522,13951262..13951500,13951603..13951775,13951922..13952092,13952146..13953608,13953664..13954616,13954669..13954707)
AA seq 1023 aa
MAAELNNTNTNESSNVASNDPMSGGPQYLPGVMNSTIQQQPQSATSSFLPSGPISSTSTS
SQVVPTSGATQQPPFPSAQAAASTALQNDLEEIFNSPPTQPQTFSDVPQRQAGSLAPGVP
IGNTSVSIGEPANTLGGGLPGGAPGQLPGGNQSGIQFQCPRRPNHGVEGRSILLRANHFA
VRIPGGTIQHYQVDVTPDKCPRRVNREIISCLISAFSKYFTNIRPVYDGKRNMYTREPLP
IGRERMDFDVTLPGDSAVERQFSVSLKWVGQVSLSTLEDAMEGRVRQVPFEAVQAMDVIL
RHLPSLKYTPVGRSFFSPPVPNASGVMAGSCPPQASGAVAGGAHSAGQYHAESKLGGGRE
VWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRV
KFTKEIRGLKIEITHCGQMRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKY
RIQLKYPHLPCLQVGQEQKHTYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPERE
REISNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWD
MRGKQFHTGIDVRVWAIACFAQQQHVKENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAV
GVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAIRTT
PQTLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVG
SMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQF
FNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTV
DVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRS
VSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSEDTTLSNMARAVQVHPDANNVM
YFA
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggctgccgaactgaacaacaccaacacaaatgagtcgtctaacgtcgcctcaaacgac
ccaatgtccggcgggccgcaatatttgccaggagtcatgaattctaccattcaacagcaa
ccacagagcgcaacatcgtcgtttctgccaagtggaccgattagttcgacgtccacctcc
tcgcaagttgttccaacatctggagccacccagcagccgcctttcccgtcggcacaagcg
gctgcgtcaacagcgctccaaaatgatctagaagaaatatttaattctccgcctactcag
ccacaaacatttagcgatgttcctcaaagacaagccggaagcctggctccaggagttccc
attggtaatacaagtgtctcaattggagaaccagcaaatacacttggaggcggtttacca
ggcggagcaccgggacaattacctggcggcaaccagagtggtattcaattccaatgtcct
cgacgcccaaaccacggagttgagggtcgctcaattcttcttcgcgccaaccactttgca
gtgagaattcctggaggaactattcaacactaccaggtcgatgttactccagacaagtgc
ccaagaagagttaatcgcgagattatcagctgcttgataagcgcattctccaagtacttc
actaatattcgccctgtttacgatggaaagcgcaatatgtacacccgcgagccccttcca
attggaagagaacgtatggatttcgatgtcacacttcctggagactccgccgttgagcgt
caattttcggtttctttgaaatgggtcggacaagtttctctctccactctggaggatgcc
atggaaggaagagttcgccaggttccattcgaagccgttcaagctatggatgtcattctt
cgtcatcttccaagcttgaaatacactcctgtcggacgttcattcttctcgccaccagtt
cctaatgcttctggagtcatggcaggatcatgccctccccaggcttctggagctgtcgca
ggaggtgcccactccgctggacaatatcacgccgagagcaaactcgggggtggccgtgaa
gtctggtttggattccatcagtcggttcgcccatctcagtggaaaatgatgcttaacatt
gatgtctctgcgactgctttctatcgttccatgccagtcattgagttcatcgccgaagtt
ttggagcttccagttcaagctcttgctgagcgtcgtgctctatctgatgctcaacgtgtc
aagttcaccaaggaaattcgtggtctcaaaattgaaatcacccactgtggacaaatgcgc
agaaagtatcgtgtctgcaacgtcactcgtcgtccagctcaaactcaaactttcccactt
caattggagactggtcaaactattgagtgcactgtcgccaagtatttctatgacaagtac
agaattcaactcaaatacccacacttgccatgcctccaagttggacaggaacaaaagcac
acctacctgccaccagaggtgtgcaacattgttccaggacaacgttgcatcaagaagctt
acggatgtgcagacatcgacaatgattaaggctacagctcgttctgctccagaacgtgag
cgtgagatttccaacttggtccgcaaggccgagttctcagctgatccatttgctcacgaa
ttcggaatcaccatcaacccagcaatgactgaagtcaagggacgcgttctttctgctcca
aaacttctctacggtggacgcactcgagccaccgctctcccgaatcaaggagtttgggat
atgcgtggaaaacagttccacactggaatcgatgttcgtgtctgggcgatcgcttgtttt
gctcaacaacagcatgtcaaggagaacgatctccgcatgttcaccaaccagcttcagcgg
atttccaacgacgctggtatgccaatcgtcggaaatccatgcttctgcaagtacgctgtt
ggagtcgagcaggttgagccaatgttcaagtacttgaaacaaaactactctggaattcaa
cttgtagtggttgttctccctggaaaaactccagtttatgctgaagttaaacgtgttgga
gacacagttttgggtatcgccacccagtgcgtgcaagccaagaacgcaatccgaacaact
ccacaaactctttctaatttatgcttgaagatgaacgtaaagcttggaggagtcaacagt
attctgcttccaaacgtacgcccaagaatcttcaacgaaccagtcattttctttggatgt
gacatcactcatccaccagcaggagactctcgcaaaccatccatcgcagcagttgtcggc
tcaatggatgctcatcctagcagatatgctgcaaccgtccgtgtccaacaacatcgtcaa
gagatcatctcagatttaacctacatggtccgcgagcttcttgttcaattctaccgcaac
actcgcttcaagccagccagaatcgttgtctaccgtgatggagtttctgaggggcaattc
ttcaacgttcttcaatatgagcttcgcgcgattcgcgaggcttgcatgatgcttgaaaga
ggatatcaaccaggaatcactttcatcgccgtccaaaagagacatcacactcgtctcttt
gctgttgataagaaggatcaagtcggaaaagcatacaatattccgccaggaactactgtc
gatgtaggaattacccacccaaccgagtttgacttctacttgtgctctcatgctggtatt
caaggaacatctcgtccatcccattaccatgttctttgggatgacaacaatctgacagcc
gacgaacttcaacagctcacatatcaaatgtgccatacctacgtcagatgcacacgatcc
gtttcaattccagcgccagcatattatgctcatttggtagcgttccgcgctcgttatcat
cttgtcgatcgcgagcatgactctggagaaggttctcagccatctggaacttccgaggat
accaccttgtcgaacatggctagagctgtgcaggttcatccggatgccaacaacgtcatg
tactttgcttaa

KEGG   Caenorhabditis elegans (nematode): CELE_R09A1.1
Entry
CELE_R09A1.1      CDS       T00019                                 

Gene name
ergo-1
Definition
(RefSeq) Piwi-like protein ergo-1
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_R09A1.1 (ergo-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_R09A1.1 (ergo-1)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_R09A1.1 (ergo-1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CELE_R09A1.1 (ergo-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    CELE_R09A1.1 (ergo-1)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     CELE_R09A1.1 (ergo-1)
   microRNA pathway
    RISC loading complex
     CELE_R09A1.1 (ergo-1)
SSDB
Motif
Pfam: Piwi PAZ ArgoL2 AAA_lid_11
Other DBs
NCBI-GeneID: 178602
NCBI-ProteinID: NP_503362
WormBase: WBGene00019971
Ensembl: WBGene00019971
UniProt: O61931
LinkDB
Position
V:join(1008813..1009753,1010595..1010779,1012120..1013038,1014099..1014373,1015079..1015158,1016368..1017230,1017971..1018073)
AA seq 1121 aa
MSYNNGGGGGGGGYRNDRDDRYHNNDRQNYRSSDQGRSGYNDDRRDNRYDDRRGSNNDRG
CYDQHDRRGSSNDDRRGYRGYNQGGGGYQQQYSQDARYGSNQRNDNYGNNRGSHGGANMY
SQNGGNRGGGGGRVGGGRTAAGMSNPGDLVGGADQPIHSVSKKSLRHNAQEFAVRPKTMV
QDKGLGQKTTLLTNHTLVQLPQEPITLHVFNIEVFINGKSSNKRELCGPRFWEILKENKP
TFGMPNQYIFNDVNMMWSTNKLRQSEGRTNNRRMNFVWKYVKQIKFGGNIEDEETMQLLS
TLIDAIATQRARLPLAPPKYTVFKRLTYLICEEAYEPELPDVSLCHKLRIGTDARVGVSI
AIRTNLRAGITACFDLGHTLFTRPAYPLVRLLCDIIEHSVVLDEAFEMKYDAALRACNVS
DENLRVMTQILTKMTLQLSTETGDYVGEDGEVIVRPAPTIRNPGRNFKFVGLGAPADRYY
FTSDGVELTVADYYLQKYNIRLRYPNLPCVLKKAPEQCGNKHSAMPLELVSYIVVPTRYG
GFTMPDMRADMINKTTYTAQQRGKLLQHIIAQKSLSGIEPPVSNNDDYMKKHKLVMKREP
IRVKATILPPPTLVYGDSVFHDEHHIGEWEAVTHDPPRQVLDGAVFRRKLYKSSEQPLMK
RLMGSILLIQSPRQCRDFDYNQQGYHAIMRAIEDSGQPVLWADENKHSAVIQGELQFNQN
QHGIEVIEQFLQNIKSTIGEYERDGEVIVPIVFAVFQARATVYSGNNNEYNDYNVLKYLA
DNKYGIHTQGILEKSLGVVGPSPKNCALTRLMVEKVLGKVGTTHRKLERGGAHKTWTIFT
DPAKPTLVLGIDVSHPSTRDRETGNVLQKMSAATVVGNIDLDVTEFRASSRIQDTGVECL
IDFSKEIDERIGEFIDHTGKRPAHIVVYRDGLSEGDFQKYLFEERVCIEERCLKIDTSFQ
PSITYIVVTKRHHTQFFLEDPSQGYESQGYNVLPGTLIEDAVTTNKYYDFFLSTQIGNEG
CFRPTHYYVLHDTWTGKPDSFWPTVTHALTYNFCRSTTTVALPAPVLYAHLAAKRAKETL
DGINTYKSVNNIYCDLESFGDLCEVNKDMNVNEKLEGMTFV
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgagctataacaacggcggcggcggcggtggtggtggctatcgaaacgatcgtgacgat
cgctaccataacaacgatcggcaaaattaccgcagcagtgaccaaggtcgctccggatac
aacgacgatcgtcgggacaatcgctacgatgatcgtcgcggctccaacaacgatcgtggc
tgctacgatcaacatgatcgtcgtggatcctccaacgatgatcgtagaggttatcgtgga
tacaaccagggtggtggaggatatcaacagcaatacagtcaggatgccagatatggatcc
aatcagagaaatgacaattatggaaataatcgtggaagtcacggcggcgcgaacatgtac
agccaaaacggtggaaaccgcggaggaggaggaggacgtgtcggtggtggccgaaccgct
gccggtatgtcgaatcctggagatctcgtcggaggtgccgaccagccgatccattcagtt
tcgaaaaagtcgctcagacacaacgcccaggagtttgcagtccggccgaaaacaatggtc
caggataagggtctcggccagaagacgacacttttgacgaatcacacgttggtgcaactc
ccgcaggagcccatcacgcttcacgtcttcaatattgaagtatttattaatggaaagtct
agcaataagcgagaactttgtgggccacgattttgggaaattttgaaggagaataagccc
acttttggcatgccaaatcagtacatcttcaatgatgtgaatatgatgtggtcgacgaat
aagctgagacaatccgagggaagaactaataaccggagaatgaatttcgtttggaaatat
gtgaaacaaatcaagtttggaggaaatattgaggatgaggagaccatgcagcttttgtca
acacttattgatgcgattgcaacgcagagagctcgcttgccacttgccccaccaaagtac
actgtgttcaaaagattaacatatctaatttgcgaagaagcgtacgaacccgagcttccg
gatgtgtcactgtgtcataaactgagaattggtacagacgcgagagttggagtttcgatt
gctattcgcacaaatctgagagccggaatcactgcatgctttgatcttggtcacacactg
ttcacacgtccagcctacccactggttcgtctcctctgcgacatcatcgagcacagtgtt
gtcctcgatgaagcctttgagatgaagtatgatgctgctctcagagcatgtaatgtttcc
gacgagaatcttcgagtcatgactcaaatcttgacaaaaatgacgctccagctgtcaact
gaaactggcgactatgtcggtgaggacggagaagtgattgttcgtccggctccaacaatc
cgtaatcctggacggaatttcaagtttgtcgggctcggagctccggccgatcgatattac
ttcacttctgatggagttgagttgaccgtcgccgactactacctccaaaagtataacatt
cggcttcgctatccaaatttaccgtgtgtcctgaaaaaagcgccggaacagtgtggaaat
aagcattcggcgatgccgttggaactcgtcagctacatagtcgttccgacgagatacgga
ggatttacgatgcccgatatgagggcagatatgatcaataagactacgtatacagctcag
caacgtggaaagcttcttcaacatatcattgctcagaagtcgctgtcgggaatcgaaccg
cccgtgtcgaacaacgatgattacatgaaaaagcataaacttgtcatgaaaagggagccg
atcagagttaaagccacaatcctaccacctccaactctggtttatggtgattctgtattc
cacgatgagcatcatatcggagaatgggaagctgttactcatgatccaccgagacaagtt
ttggatggtgctgtgtttcggagaaaactctataagtcttctgagcagccgctcatgaag
cgtctcatgggctcgattcttctgattcaatcgccgagacaatgtagagatttcgattac
aatcagcaaggatatcacgcaatcatgagagccatcgaagacagtggtcaaccagtgttg
tgggctgacgagaataagcattcggccgtgatccagggagagctccaatttaatcaaaat
cagcatggaatcgaagtaattgagcaattcctccaaaatatcaaatcgacaattggcgag
tacgaacgagacggcgaagtcatcgttccgattgtttttgccgttttccaggcgagagcc
actgtgtattctggcaacaataatgagtataatgattataatgttctcaagtatcttgcc
gataacaagtatggaatccacactcaaggaattctcgagaaaagtctcggagttgttggg
ccttcaccaaagaattgcgccctaacccgattgatggtggaaaaagtgctcggaaaagtc
ggaaccactcatcgcaagcttgaacgcggcggagctcacaagacatggacaattttcaca
gatcccgccaagccaacgctagttctcggaatcgacgtttctcatccatcgactcgtgat
cgtgagactggtaatgtacttcagaaaatgtctgcagcgaccgtcgtcggaaatattgat
ctagatgtcaccgaattccgagcatcttcaagaattcaggatacaggtgtcgagtgtctg
atcgatttctcgaaagagatcgatgaacgaatcggagagttcatagatcacactgggaaa
cgtccagcacatattgttgtctatcgtgacgggctatcagagggagatttccaaaagtac
ctgttcgaggagcgcgtttgcattgaggaacgatgccttaaaatcgacacctcattccaa
ccatcaataacgtatatcgtagttaccaagcgacatcatactcaattcttcctagaagat
ccgagtcaaggatacgaatcacagggttacaatgtcctaccgggaactttaatcgaagac
gctgttaccaccaacaagtactacgatttcttcctctccacacagatcggcaatgaagga
tgtttccgtccaactcattactatgtgcttcacgatacgtggaccgggaagcccgactcg
ttctggccgactgtcacgcatgcgttgacctataatttctgtagatcaacgaccactgtc
gcgttgccagcgccggtgttgtatgctcatttggcggcgaaacgtgccaaggagacgctg
gatggaatcaatacgtacaagtcagtaaataatatctactgcgacctcgaatcattcgga
gacctctgcgaagtcaacaaggacatgaatgtcaacgaaaagctcgaaggaatgacattt
gtctaa

KEGG   Caenorhabditis elegans (nematode): CELE_T07D3.7
Entry
CELE_T07D3.7      CDS       T00019                                 

Gene name
alg-2
Definition
(RefSeq) Protein argonaute
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_T07D3.7 (alg-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_T07D3.7 (alg-2)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_T07D3.7 (alg-2)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CELE_T07D3.7 (alg-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    CELE_T07D3.7 (alg-2)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     CELE_T07D3.7 (alg-2)
   microRNA pathway
    RISC loading complex
     CELE_T07D3.7 (alg-2)
SSDB
Motif
Pfam: Piwi ArgoMid PAZ ArgoL1 ArgoN ArgoL2
Other DBs
NCBI-GeneID: 173468
NCBI-ProteinID: NP_871992
WormBase: WBGene00000106
UniProt: O16720
LinkDB
Position
II:join(873212..873266,874160..874262,874860..875033,875103..875443,875735..876796,877028..877986,878438..878476)
AA seq 910 aa
MFPLPVHNGPRLGKLSIFEMPGDSLTSSSFMPDGGAETSSSSQLGGSAHGAIGTKPDAGV
QFQCPVRPNHGVEGRSILLRANHFAVRIPGGSVQHYQIDVFPDKCPRRVNREVIGCLISS
FSKYFTNIRPVYDGKRNMYTREPLPIGTEPMNFEVTLPGDSAVERKFSVTMKWIGQVCLS
ALDDAMEGRVRQVPHEAVQSIDVILRHLPSLKYTPVGRSFFTPPGVMKPGMQMHQESKLG
GGREVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSD
AQRVKFTKEIRGLKIEITHCGAVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYF
FDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCDIVPGQRCLKKLTDVQTSTMIKATARSA
PEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPN
QGVWDMRGKQFHTGMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMF
CKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKN
AIRTTPQTLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSI
AAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGV
SEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIP
PGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYV
RCTRSVSIPAPAYYAHLVAFRARYHLVDRDHGSGEEGSQPSGTSSEDTTLSSMAKAVQVH
PDSNNVMYFA
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgttccctctgcctgtacacaatggtcctagacttggaaaattatcgattttcgaaatg
cccggcgattcgctgacatcgtcgtctttcatgccagatggtggcgcagaaacgtcgagc
tcttcacagttgggcggctcggctcacggagcaattggcacaaaacccgacgcaggcgtc
caattccagtgcccagtccgtccgaaccatggagtcgagggccgatccatcctcctgcga
gccaatcattttgcagtacggatccccggaggttcagtccaacattatcaaattgacgtc
tttccggacaagtgcccaagacgggttaatcgcgaggtaatcggctgcctgatctcctcc
ttctcaaaatatttcaccaatattcgaccagtctacgatggaaagcgtaacatgtacacg
cgggagcccctaccaattggcacggagcccatgaactttgaggtgacgctgcctggagat
tcagcagtggaacggaagttctcagtgacgatgaagtggatcggtcaggtctgtctgtca
gctctggacgatgccatggaaggtagagtgcggcaggttccacatgaagccgttcagtcg
atcgatgtgattcttcgccacttgccaagtttgaagtacaccccggttggaaggtcgttt
ttcacacctccaggcgtcatgaagcccggcatgcaaatgcaccaggagagcaaactcggt
ggaggccgcgaagtatggtttggattccatcaatccgtccgaccatcccaatggaagatg
atgctcaacattgacgtctccgccacggccttttaccgcgcgatgccagtcatcgaattc
gtcgccgaggtgctcgagctcccagtccaagctctcgccgagcgtcgggccctctccgat
gctcaacgcgtcaaattcaccaaagagatccgtggactcaagattgagatcacccattgt
ggagccgtgcgccggaagtacagagtttgcaacgtcacacgccgcccggcccagacccag
accttcccattgcaactggagactggccaaactattgagtgtactgtagccaagtacttc
tttgacaagtaccgtatccagctgaagtacccccaccttccatgcctccaagtcggtcag
gagcagaagcatacgtacctgccaccagaggtctgcgatattgttccaggacagcgttgt
ctgaagaagctcaccgatgtgcagacgtccaccatgatcaaggccacggctcgttccgct
ccagagcgtgagcgtgagatttgtaagctagtaagcaaggctgagctctccgcggatcca
tttgctcatgaattcggaatcactatcaatccagcaatgactgaagtcaagggacgtgtg
ctctcggctccgaagcttctctatggaggtcgtcatcgtgccacaactgcccttccgaac
cagggagtctgggatatgcgcgggaagcagttccacactggaatggaagtccgtacctgg
gcgattgcatgctttgctcagcaatctcatgtcaaggaaaatgatctcaggatgttcacg
actcaattgcaaaggatctctaccgacgctggaatgccaatcatcggtacccctatgttc
tgcaaatatgcttctggagtggagcaggtggagccgatgttcaagtacttgaagcagacc
tattcggcgattcagttgattgtggtggtgctgccaggaaagactccgatctatgccgaa
gtgaaacgcgtcggagacaccgtcctcggaatcgccacccagtgcgtccaggccaagaac
gccatccgaaccaccccgcagacactctccaacctctgtctcaagatgaatgtgaagctt
ggtggagtcaacagcatcctcctgccaaacgtgcgtccacggatcttcaacgagcccgtc
atcttcctgggttgcgacatcacccatccagcagccggtgatacccgtaagccatccatc
gccgcagtggtaggatctatggatgctcacccgagtagatatgcggcaacagttcgggtc
cagcagcaccgtcaggagatcattacggatctgacatatatggttcgagagttgcttgtc
cagttctaccgtaacacgaggttcaagccagcccgaattgtggtctacagagatggagtg
tctgagggtcaactcttcaatgtgctccaatatgagctccgcgcaattcgtgaagcttgt
gtgatgcttgagagtggataccagccaggaatcacatttatcgctgtgcaaaagagacat
cacacaaggctcttcgccgcggataaagctgatcaagtaggaaaagcattcaacatccca
ccaggaacaactgtagatgtgggaatcacgcatccaacggaattcgacttcttcctctgc
tcccacgctggtatccaaggaacatcccgaccatctcactaccatgtgctctgggatgac
aatgatctgacggccgacgagcttcaacagttgacctaccaaatgtgtcatacctatgta
agatgcacgaggtctgtgtcgatcccggcgccggcgtactatgcacatctggtggcgttc
cgtgctcgttatcacttggtcgatagggatcatggatccggagaggaaggatcacaacct
tcggggacgtcgtcggaggatacaacattgtcaagcatggccaaggccgtacaggttcat
cccgactcgaacaacgtcatgtattttgcctaa

DBGET integrated database retrieval system