KEGG   Caenorhabditis elegans (nematode): CELE_F57C7.3
Entry
CELE_F57C7.3      CDS       T00019                                 

Gene name
sdn-1
Definition
(RefSeq) Syndecan
  KO
K16336  syndecan 2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F57C7.3 (sdn-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cel04090]
    CELE_F57C7.3 (sdn-1)
   00535 Proteoglycans [BR:cel00535]
    CELE_F57C7.3 (sdn-1)
CD molecules [BR:cel04090]
 Proteins
  CELE_F57C7.3 (sdn-1)
Proteoglycans [BR:cel00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   CELE_F57C7.3 (sdn-1)
SSDB
Motif
Pfam: Syndecan Pox_Ag35 FAM176 DUF2722 Nop14 Glycophorin_A RXT2_N NOA36 PTP_tm MGC-24 PPP4R2 PI3K_1B_p101 Cytomega_TRL10
Other DBs
NCBI-GeneID: 181259
NCBI-ProteinID: NP_741893
WormBase: WBGene00004749
Ensembl: WBGene00004749
UniProt: Q8I4H9
LinkDB
Position
X:complement(join(10590355..10590530,10591992..10592110,10592257..10592468,10592523..10592623,10592757..10592859,10593126..10593278))
AA seq 287 aa
MILKLNFCLSTYSVLILLSLSTQAFAANQAKTKVVPSSTISTKSLKNGISEVEGSANIPG
RLADIEVNGSGYPTDDEDGDDVHGSGKPPSSATTKSDKVTSPSHAVVTAKPTTVPTTTAS
FKPPVQPKPKPAANDKEIKVEEDEDDDEDEDEDDEDDEEDFADENIHNDEDFFTTTTTTT
YRPIVVATTSTPRSAATNPPRQQPPMVTSTISSGPFSPFHETLANGFYAAIAGGVLVAVI
TAILLVLFVVFRIRKKDEGSYALDEPKQARPYASYGYTKASTKEFYA
NT seq 864 nt   +upstreamnt  +downstreamnt
atgattctgaaactcaatttctgcctgtcgacttactcggtcctcattctcctatcctta
tctacacaagctttcgccgcaaatcaagcaaaaacgaaagtggtcccttcgtcaactatt
tctacgaaaagcttgaaaaatggaatatctgaagtcgaaggaagtgcaaacattcccggc
aggttagcagacatcgaagtcaatggatccggctacccaaccgacgacgaagacggtgat
gatgtccatgggtcaggcaagccgccatcttcagctaccacaaaatcggacaaggttaca
tctccaagccatgctgttgtgactgcaaagccgacaacggtacctactactacagcgagc
ttcaagcctcctgttcagcccaagcctaagccagcggcaaacgacaaggagatcaaggtc
gaggaggacgaggacgatgatgaagatgaggatgaagatgatgaggatgatgaagaagat
tttgctgatgagaatattcataatgatgaagatttcttcacaactactactacaacaacg
tatcgacctattgttgtagctaccacctcaacgccaaggtcagcagccacaaatccacct
cgacagcagccaccaatggtcacatcaaccatctcatctggaccattctcgccattccat
gagacactggcaaatggcttctatgcagctattgccggaggtgttctcgttgcggtgatt
acagccattctactcgtgctctttgtagtctttcgaatcaggaaaaaagatgaagggtca
tacgcattggatgaacccaagcaagcaagaccatatgcctcgtatggttataccaaagca
tcgacaaaagaattttacgcgtaa

DBGET integrated database retrieval system