KEGG   Caenorhabditis elegans (nematode): CELE_K08A8.1
Entry
CELE_K08A8.1      CDS       T00019                                 

Gene name
mek-1
Definition
(RefSeq) Dual specificity mitogen-activated protein kinase kinase mek-1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04141  Protein processing in endoplasmic reticulum
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_K08A8.1 (mek-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_K08A8.1 (mek-1)
   04012 ErbB signaling pathway
    CELE_K08A8.1 (mek-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_K08A8.1 (mek-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_K08A8.1 (mek-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_K08A8.1 (mek-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: STE group
  STE7 family
   CELE_K08A8.1 (mek-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 181004
NCBI-ProteinID: NP_001024771
WormBase: WBGene00003185
UniProt: Q21307
LinkDB
Position
X:join(7479256..7479439,7479489..7479721,7479772..7479915,7479971..7480282,7480409..7480579)
AA seq 347 aa
MERDFDLGMGRPGGLGGLGGEPIMQQMPQPAPHHPSRSSNDHNVKNLMKQAEENSGYLTL
QGNRRKADLKELQFVEDIGHGSCGTVTKCRYKSVIMAVKTMPRTSNSYEMSRILMDLDVI
CLSFDCPYIVRCFGYFITNFDVRVCMECMATCLDRLLIRIKQPIPERIIGKLSVSIIKAL
HYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPLYMGPERLD
PNNFDSYDIRSDVWSFGVTLVELATGQYPYAGTEFDMMSKILNDEPPRLDPAKFSPDFCQ
LVESCLQRDPTMRPNYDMLLQHPFVVHHEKIETDVEEWFADVMGECG
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagagagacttcgaccttggcatgggcagacctggcgggctcggaggacttggtggt
gaaccgatcatgcaacaaatgccacagccagcgcctcatcatccatcccgtagtagtaac
gaccacaatgtgaagaacctcatgaagcaggccgaggagaactccggatatctcacattg
caaggtaaccgtcgtaaagctgacttgaaggagcttcagttcgtggaagatattggtcat
ggaagctgcggtacggtcacaaagtgcagatacaagagtgtgatcatggctgtgaagacg
atgcctcggacgtcaaacagttatgaaatgtcccgcattttgatggatcttgacgtcatc
tgtctctctttcgactgtccgtacattgtacgttgcttcggatacttcatcaccaacttc
gacgtccgtgtctgcatggagtgcatggctacttgccttgaccgtctgcttatccgcatc
aagcagccaattccagagagaattattggaaagttgagtgtgagcatcattaaagctctg
cactacttgaaaaccaagcaccaaatcatgcaccgtgatgtgaagccatcaaacattctc
ctcgactggagtggcgtcatcaagctttgcgatttcggtattgctggcagactgatcgag
tctcgtgctcattcgaagcaagccggatgccctctgtacatgggtcctgagcgcctcgac
cccaacaactttgactcgtatgacattcgcagtgacgtgtggtcttttggtgttactttg
gtcgagctggcaaccggacagtacccatacgccggaaccgaattcgacatgatgtccaag
attctcaatgacgagccaccgcgcctggatccggccaaattctctccggacttctgtcaa
ctcgtcgagagctgcctgcagcgtgatccaacgatgcgtcccaattacgatatgctcctc
cagcatccgtttgtcgtgcatcacgagaaaattgaaaccgacgtcgaggagtggtttgcc
gatgtgatgggcgagtgcggataa

DBGET integrated database retrieval system