KEGG   Caenorhabditis elegans (nematode): CELE_K11D12.10
Entry
CELE_K11D12.10    CDS       T00019                                 

Gene name
mlk-1
Definition
(RefSeq) Mitogen-activated protein kinase kinase kinase mlk-1
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_K11D12.10 (mlk-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_K11D12.10 (mlk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     CELE_K11D12.10 (mlk-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: TKL group
  MLK family
   CELE_K11D12.10 (mlk-1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 178895
NCBI-ProteinID: NP_001300152
WormBase: WBGene00003374
Ensembl: WBGene00003374
UniProt: A0A0K3AV08
LinkDB
Position
V:complement(join(5056780..5057011,5058467..5058582,5058634..5058972,5059300..5059549,5059913..5060204,5060962..5061158,5061213..5061445,5061502..5061650,5061698..5061862,5061915..5062184,5062232..5062340,5062667..5062886,5063857..5063948,5064011..5064174,5064726..5064777))
AA seq 959 aa
MEQASVPSYVNIPPIAKTRSTSHLAPTPEHHRSVSYEDTTTASTSTDSVPEVRIRSESSQ
VSRESPPIRASKAFVASYEYEAQKDDELNLPLGAIITLVTVETNEDGWYRGELNGKVGLF
PSNYAREVTYKDNLVEFKQDEIMLPVAVRTLSDCQIGHGATATVFKMDIKIKKELQNGRM
GEAVGDQMKAALKRFNRHASNFRADVVSTDEQLEQLKREANLVNGLSHNNIVRLLGICLE
DPYFGLLLELCEGSSLRNVCRNLNSDAAIPLGVLIDWATQVAEGMEYLTKQGYVHRDLKA
DNVLVKEEVCLCMDEEMFQYAYCLKCGKRPFDKLQLKITDFGVTRKMTADANRFSTAGTY
AWLAPEAFKEGTWSEASDVWSYGVVLWELLTREEPYQGHIPATIAFQIANKGQNLSIGDS
CPDRWKKLMQDCWNLEPNFRPKFSTLAISFKQYAKEFKDTHLQRAPSKMAVKELYSECFA
DKTKEEFEKRFHDLYAGSGDINRKNRHSIAPETKARRLKHHKPKKADITGPTEVKHILSV
QKDDKNFRVKIDNADEVDPNHSKESKKGGTLSRAWAKLPWNKRDSKEDHDERAVAGSISS
RSSSTTSSNRLITGQTTRGASAAGLLEIGARSRAQSTADGWEDPNTTKRYVKDLEKDTPL
RPAQLPPTHRKSALDQTIPASPNSPDSINNFHPMPLSSRRTTANSSSDGAPCYDALVSHS
YGAGHGHKNHFGLSDTIPLFPEEPTHYDMGPGRPFGTNGRAIVNQGGDYYGNISGQNYEG
FGHGRSINQSTQYYPVGGGCDDYIPIVQKTVIKPTVGEVGNSPYSENIRCATRNVQNPQY
IQCKKNQNPRRIPALPMKIQSESNLVTSGMVFTPRDEQLNGIGNSLSSLSLNEPPDIPAP
LPPVVTYPIPASLISPSNRVSMSPPTRMAPVLPLGAMSSPRIMDKEILKNSSVEGTEIY
NT seq 2880 nt   +upstreamnt  +downstreamnt
atggaacaggcttcggtcccgtcttacgtgaacattccaccaatagccaaaacaagaagc
acaagccacctggcacccactcccgaacaccatcgatcggtgagctatgaggacacgacg
acagcatcaacgagcacagattcggttccagaagttcggattagatctgaaagttcgcag
gtttcacgtgaatctccaccaatccgtgcgtcaaaggcgtttgttgcatcttacgagtat
gaagcacaaaaagatgacgagttgaatttgccacttggagcgattatcacactggtcact
gttgaaacaaacgaagatggttggtatcgaggtgaactgaacggaaaagtcgggttattc
ccttcaaattatgcgagggaagtgacgtataaggataatttggtggagttcaaacaggat
gaaatcatgcttccagttgctgtgagaacattgtccgattgtcaaattggacatggtgcc
actgcgaccgtattcaaaatggatattaaaattaagaaggagttgcagaatggtcgaatg
ggagaagcagttggtgatcagatgaaagcggcactcaagcgattcaacagacatgcatct
aattttcgagctgatgtagtttcgacggatgagcaattagagcaactgaaacgagaagcc
aaccttgtgaacggtctgtcccacaacaacattgtccgtttgctaggaatctgtctggaa
gatccgtatttcggattgcttctcgagctgtgcgaggggtcttcgttgcgaaacgtttgt
cgaaatttaaactcggatgcagctatcccattaggagtgcttattgactgggcaacgcag
gttgcagaaggaatggaatatctaaccaaacagggatatgttcatagagatttgaaagcg
gataatgttcttgtcaaagaagaagtttgtctgtgcatggacgaggaaatgttccagtat
gcctattgtctgaagtgcggaaaacgtccatttgacaagctccaactaaagatcaccgat
tttggagttacaagaaagatgaccgccgatgccaatagatttagtactgcaggcacctac
gcgtggcttgctcctgaagcatttaaagaaggaacatggtcagaggcatcagatgtctgg
tcgtatggtgttgttctttgggaactgctcacacgagaggaaccatatcaagggcatatt
ccagctacgattgcatttcagatagcaaataaaggacaaaatttgtcaattggcgatagc
tgcccggataggtggaaaaaattaatgcaagactgctggaatctggaaccaaattttcga
ccgaagttttcaacacttgcgatttcatttaaacagtacgccaaagagttcaaagacaca
cacttacaacgggcaccctcgaaaatggctgtcaaagaactttattccgaatgctttgct
gataagaccaaagaggaattcgagaaacgattccatgatctttatgcgggaagtggtgat
ataaatcgaaaaaatcggcattccatcgcgccggaaaccaaagcaagacggttaaagcat
cataaaccaaaaaaagccgacataacgggtccgacagaagtgaaacatatattgtctgtg
caaaaggatgataaaaattttagagttaaaatcgacaatgccgatgaggtagacccaaat
cattcgaaagaatccaaaaaaggaggaacattatcaagagcctgggctaaactaccatgg
aacaagcgagactcaaaagaggatcatgatgaaagagcagtggctgggagcatatcaagc
agatctagttcaactacttctagcaacaggctgattaccgggcaaacaacaagaggagct
tctgccgccggattgctggaaattggagcaagatcgagagctcaatcaacagctgatgga
tgggaagatcctaatacgacaaaacgatatgtcaaagacctcgagaaagatacgcctcta
cgtcctgcacaactccctccaactcaccggaaaagtgctctggatcagacgattcctgca
agtccaaactctcccgattcaatcaataattttcacccaatgcctctgtcttctcgacga
acaactgcaaattcttcatctgacggagcaccttgctatgatgctttggtgtcgcattcg
tatggagctggccatgggcataaaaatcattttggtctctccgacaccattcccctcttc
cccgaagagccaacccattacgacatgggtccaggaagaccgttcggaacgaatggacga
gctatagtaaatcaaggaggagactactacggtaatatatcgggtcaaaactatgaagga
tttggtcacgggcggtcaattaatcaatccacgcagtattacccagttggcggcggttgt
gacgactacataccaattgttcaaaaaactgtgatcaagccaacagttggagaagtcggt
aattctccgtactcggaaaatatacggtgtgcaacaagaaatgtgcagaatcctcagtat
attcagtgcaagaaaaaccaaaatccaaggcgtatcccagcattgccaatgaaaattcaa
tcggaaagcaacttagtgacaagtggaatggtgttcacacctcgtgatgaacagctaaac
ggaataggaaacagtctgagctcgttgtcactgaacgagccgcctgatattccggctccc
ttgccaccagtcgtcacctacccaataccagcatctctaatatcgccatcaaaccgtgtt
tcaatgtccccgccgactcgaatggctccagtcttacccctcggcgcaatgtcttctcca
cgcataatggataaggagatattgaagaatagtagtgtcgaaggaaccgagatctattga

DBGET integrated database retrieval system