KEGG   Caenorhabditis elegans (nematode): CELE_R107.8
Entry
CELE_R107.8       CDS       T00019                                 

Gene name
lin-12
Definition
(RefSeq) Protein lin-12
  KO
K02599  Notch 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04330  Notch signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    CELE_R107.8 (lin-12)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_R107.8 (lin-12)
SSDB
Motif
Pfam: EGF Ank_2 hEGF Notch Ank Ank_3 Ank_4 NOD Ank_5 NODP EGF_CA EGF_2 EGF_3
Other DBs
NCBI-GeneID: 176282
NCBI-ProteinID: NP_499007
WormBase: WBGene00003001
Ensembl: WBGene00003001
UniProt: P14585
LinkDB
Structure
PDB: 
3BRD 2FO1

Position
III:complement(join(9060402..9060524,9060912..9061259,9061570..9063493,9063542..9063670,9063717..9063849,9064154..9065270,9066723..9066913,9067929..9067985,9069601..9069719,9071240..9071388))
AA seq 1429 aa
MRIPTICFLFLLISLSKSLHIGSCLGLICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYC
EQQCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQGWCYP
SVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVC
PQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGY
HGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGS
KCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGI
LCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCM
HTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGFC
VCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDIC
ERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINE
EEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCDADCNYAA
CKFDGGDCSGKREPFSKCRYGNMCADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKI
REHCASRFANGICDPECNTNGCGFDGGDCDNETNATIITNIRITVQMDPKEFQVTGGQSL
MEISSALRVTVRIQRDEEGPLVFQWNGESEMDRVKMNERQLTEQHVLSTSISRKIKRSAT
NIGVVVYLEVQENCDTGKCLYKDAQSVVDSISARLAKKGIDSFGIPISEALVAEPRKSGN
NTGFLSWNALLLIGAGCLIVMVVLMLGALPGNRTRKRRMINASVWMPPMENEEKNRKNHQ
SITSSQHSLLEASYDGYIKRQRNELQHYSLYPNPQGYGNGNDFLGDFNHTNLQIPTEPEP
ESPIKLHTEAAGSYAITEPITRESVNIIDPRHNRTVLHWIASNSSAEKSEDLIVHEAKEC
IAAGADVNAMDCDENTPLMLAVLARRRRLVAYLMKAGADPTIYNKSERSALHQAAANRDF
GMMVYMLNSTKLKGDIEELDRNGMTALMIVAHNEGRDQVASAKLLVEKGAKVDYDGAARK
DSEKYKGRTALHYAAQVSNMPIVKYLVGEKGSNKDKQDEDGKTPIMLAAQEGRIEVVMYL
IQQGASVEAVDATDHTARQLAQANNHHNIVDIFDRCRPEREYSMDLHIQHTHQPQPSRKV
TRAPKKQTSRSKKESASNSRDSTHLTPPPSDGSTSTPSPQHFMNTTHTTPTSLNYLSPEY
QTEAGSSEAFQPQCGAFGNGEMWYTRASTSYTQMQNEPMTRYSEPAHYF
NT seq 4290 nt   +upstreamnt  +downstreamnt
atgcggatccctacgatttgttttttatttcttcttatctcgttatcaaaatcgcttcat
attggctcatgtcttggcttaatatgtggaagaaatggtcactgccatgctggacctgtc
aatggaactcaaacttcttattggtgcagatgcgatgaaggatttggtggtgaatattgt
gaacaacagtgtgatgtttcaaaatgtggagccgatgagaaatgtgtttttgacaaagat
tatcggatggagacctgtgtctgtaaagattgcgacattaacggaaacagtctactaaaa
ccaagctgtccatccggttacggaggagacgactgtaagacacaaggatggtgttacccg
tctgtctgtatgaatggtggacagtgtattggagctggaaatcgagcaaaatgtgcatgt
ccagatggatttaagggggagagatgcgaacttgatgtcaatgaatgtgaagagaacaaa
aatgcatgtggaaataggagtacttgtatgaatacgctcggtacatacatttgcgtgtgt
ccccaaggattccttcctccggattgtctaaaacctgggaacacatcgaccgtcgaattc
aagcaaccagtttgttttctagaaatctcagcagatcatccagatggacgaagtatgtac
tgtcaaaatggtggattttgtgataaggcctcgtcgaaatgccagtgtccacctggatac
catggaagtacttgtgagttgttggagaaggaagattcatgtgcatcaaatccttgttct
catggagtttgtatttcattttctggaggatttcaatgtatttgtgatgatggatatagt
ggatcttattgtcaagaaggaaaggataattgtgtgaataataaatgcgaagctggatca
aaatgtatcaatggagtgaattcatatttctgtgattgcccaccagagagaaccggacca
tattgtgaaaagatggattgttctgcaattccagatatttgcaatcatggaacctgcatt
gatagtcctctatctgaaaaagctttcgagtgtcaatgtgaaccaggttatgagggaatt
ctctgtgaacaggataaaaacgaatgcctttcggaaaacatgtgcctgaataatgggaca
tgtgtcaatctgccaggctcatttcgatgcgattgtgcacgtggattcggtgggaaatgg
tgtgacgagccattgaatatgtgtcaagattttcactgtgagaatgatggaacttgtatg
cacacttctgatcactcacccgtatgtcagtgtaaaaacggatttattggaaaacgatgt
gaaaaggaatgtccaatcggattcggaggtgttcggtgtgatcttcgattggaaattgga
atatgctcacgacaaggtggaaagtgtttcaatggaggaaaatgtcttagcggattctgt
gtttgtccacctgattttactggaaatcagtgtgaagtcaacagaaaaaatgggaaaagc
tcgttatcagagaacctgtgtctatcggatccatgtatgaacaatgccacgtgtatcgat
gtagatgcccatattggatatgcatgtatatgtaaacaaggattcgaaggagatatttgt
gaaagacataaagatctttgtctcgagaatccatgctccaatggaggagtttgccatcaa
catcgtgagtcattctcatgcgattgcccgccagggttctatggaaatggttgtgaacag
gaaaaaatgttccgctgtctcaagagcacttgccaaaacggaggagtttgtattaatgaa
gaagagaagggaagaaaatgtgaatgttcatatggatttagtggagccaggtgtgaagaa
aaaatcaatttgactgggtttaccgagaaagacagccttctgcgatcagtttgcgagaaa
agaaaatgctccgagagagctaacgatggaaactgtgatgctgactgcaactatgctgca
tgtaaattcgacggaggtgactgttcaggaaaacgggaaccattttccaagtgtcgatat
ggaaatatgtgtgctgatttttttgcaaatggagtttgtaatcaagcttgtaacaatgaa
gaatgtctttacgatggaatggattgtttacctgcagttgttagatgtccagttaagatt
cgagaacattgtgcttcaagatttgcaaatggaatctgtgatccagaatgtaatacaaat
ggatgtggttttgatggtggtgattgtgataatgaaacgaatgccacaattatcacaaat
attcgaatcacagttcaaatggatcctaaagaatttcaagtaaccggaggtcaatcactt
atggagattagttcagctcttcgtgtaactgtccgaattcaaagagatgaagaaggacct
ctcgtgtttcaatggaatggggaatctgaaatggatcgagtcaaaatgaatgagagacag
ctcaccgagcaacatgttctttccacatcaatttccagaaaaatcaagagaagtgcaacg
aatattggagttgtcgtctatttggaagttcaagagaattgtgatacaggaaaatgtctc
tacaaggatgctcaaagtgttgttgactcaatatctgcaaggcttgcaaagaagggaatc
gattcttttggtattccaatctcagaagctcttgtcgcagagccaagaaaatctggaaac
aatacaggattcttatcatggaatgctcttcttctaattggtgctggatgtctgattgtt
atggttgttctgatgttaggagcattacctggaaatcggacaaggaaacgtcgaatgatc
aacgcctctgtctggatgccacctatggagaatgaggagaagaatcggaaaaaccatcaa
tcaataacttcaagtcagcattcacttctggaagcttcttatgatggttatatcaaaagg
caaagaaatgaactgcaacactattccttgtatccaaatcctcaaggatacgggaatgga
aatgatttccttggtgatttcaaccataccaatcttcaaattccaactgaacctgaacct
gaaagccccatcaaactacacacagaagctgcaggaagctatgcaattactgagcctatt
actagggaatccgtgaatattattgatccaaggcacaatagaacggttttgcattggatt
gcatcgaattcctcagccgaaaagtcagaagatttgattgtacatgaagctaaagaatgt
attgcggcaggagccgatgtgaatgctatggattgcgacgagaacaccccattgatgctg
gctgttcttgcaagaagacgacggcttgtggcttatctgatgaaagctggagccgatcca
accatctacaataaatctgaacgaagtgctcttcatcaagcggctgcaaatcgagatttt
ggaatgatggtctacatgttgaatagtacaaaattgaagggagatatcgaagaacttgat
agaaacggaatgacagccctgatgattgtagcacataatgagggaagagatcaagttgca
tctgcaaagttactcgttgaaaaaggagcaaaagttgattatgatggagctgcgagaaaa
gattcagaaaagtataaaggcagaacggcacttcactatgctgcccaagtgagtaatatg
ccaattgtgaagtatttggttggagagaaaggatccaataaggataagcaagatgaagat
ggaaagacgccgattatgttagctgcacaggaaggacgtattgaagttgtgatgtatttg
attcagcaaggggctagtgttgaagcggttgatgctacggatcatacggctcgtcaactc
gctcaagcaaataaccatcacaatattgttgatatttttgatagatgtcgtccagaacga
gaatattcaatggatcttcacatccaacatacccatcaaccacaaccttcaagaaaagta
actcgagctccgaagaaacagacaagtcgaagcaaaaaagagtcagcttccaattctcga
gactcaactcatctgacacctccaccatcggatggatcaacgtcaacaccgtcaccacag
cattttatgaataccactcatactacaccgacgagtttgaactatttgagcccagaatat
caaactgaagctggaagctcagaagcgttccaaccacaatgtggagcatttggaaatggc
gaaatgtggtatacaagagcttcaacatcgtacacccaaatgcagaatgaaccaatgacg
cgatactccgaaccagctcattatttttga

DBGET integrated database retrieval system