KEGG   Caenorhabditis elegans (nematode): CELE_T07C4.8
Entry
CELE_T07C4.8      CDS       T00019                                 

Gene name
ced-9
Definition
(RefSeq) Apoptosis regulator ced-9
  KO
K20094  cell death protein 9
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_T07C4.8 (ced-9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_T07C4.8 (ced-9)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_T07C4.8 (ced-9)
SSDB
Motif
Pfam: BH4 Bcl-2
Other DBs
NCBI-GeneID: 3565776
NCBI-ProteinID: NP_499284
WormBase: WBGene00000423
UniProt: P41958
LinkDB
Structure
PDB: 
1OHU 1TY4 2A5Y

Position
III:join(10335172..10335423,10335472..10335732,10336264..10336413,10336901..10337080)
AA seq 280 aa
MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRM
SIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMG
TIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGF
VAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEA
EKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacacgctgcacggcggacaactcgctgacgaatccggcgtatcggcgacgaacgatg
gcgactggcgagatgaaggagtttctggggataaaaggcacagagcccaccgattttgga
atcaatagtgatgctcaggacttgccatcaccgagtaggcaggcttcgacgcgaagaatg
tccatcggagagtcaattgatggaaaaatcaatgattgggaagagccaaggcttgatatc
gagggatttgtggtcgactatttcacgcaccgaatccggcaaaacggaatggaatggttt
ggagcaccgggattgccgtgtggagtgcaaccggagcacgaaatgatgcgagttatggga
acgatattcgagaagaagcacgcggaaaattttgagaccttctgtgagcagctgctcgca
gtgcccagaatctcattttcactgtatcaggatgtggttcggacggttggaaatgcacag
acagatcaatgtccaatgtcttatggacgtttgataggtctaatctcgttcggcggtttc
gtagctgcaaaaatgatggaatccgtggaactgcagggacaagtgcgaaacctcttcgtt
tacacatcgctgttcatcaaaacgcggatccgcaacaactggaaggaacacaatcggagc
tgggacgacttcatgacactcggaaaacaaatgaaagaggactacgaacgagcagaagct
gaaaaagtgggacgccggaagcagaacagacggtggtcgatgattggcgctggagtaaca
gctggagccattggaatcgttggagtcgtcgtgtgtgggcggatgatgttcagcttgaag
taa

DBGET integrated database retrieval system