KEGG   Caenorhabditis elegans (nematode): CELE_Y50D4C.1
Entry
CELE_Y50D4C.1     CDS       T00019                                 

Gene name
unc-34
Definition
(RefSeq) WH1 domain-containing protein
  KO
K23487  Ena/VASP-like protein
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y50D4C.1 (unc-34)
SSDB
Motif
Pfam: WH1 VASP_tetra AAA_lid_1
Other DBs
NCBI-GeneID: 190098
NCBI-ProteinID: NP_503360
WormBase: WBGene00006770
UniProt: G5EG53
LinkDB
Position
V:join(982706..982710,985096..985475,987096..987192,990236..990657,992925..993168,994205..994330,995272..995404)
AA seq 468 aa
MSSEACIATAMARVMTYNESTKGWVLLGGNDDSMTNVRLIQDIRRPEFRIVSNRADSTNI
LNCNIYRGIKYHKATPMFHQWRTEQRRVYGLNFENEQDATMFLSIVLQAIETLKVHDMNG
ISDYQQMHQVDNVYQDPHQHLMHIHSAPNFHDENQNAANFRKTSQHASSLLSSTAAALTQ
QQRRASQSSSTSAGSSIPHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLP
PVGAGAPPPPPPPPPPAQLMASSGTPSLAEQLKMRSQQGLKATSNGVKAAAAEPEKPAAK
GAGNLMSELEAQLNKRKMTQAKSDAVDSKSNTSNGSSDSGCGTATSTNGCGSSNGGSVGS
AAAKKWSVSDATKPMDSPKTHRKLPSASSLFSQEDSSSSSSSTLTPSKPTTNGTSSAIPN
DLLERLRADIMVEMRLEMNKLEQRIVEANDRAVDRAVETILNAIGGRR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgagtagcgaagcatgtatcgcgacggcaatggcccgagtgatgacctacaacgaatcg
acaaaaggatgggtactactcggcggaaatgatgattcaatgacaaatgttcgcctaatc
caagacattcggcgacccgagtttcggattgtatccaaccgcgctgacagcacgaatatc
ttgaattgtaatatttatcgaggaatcaaatatcacaaggccacaccaatgtttcatcaa
tggcgtaccgaacagcggcgggtgtatgggctgaatttcgagaatgaacaggatgcgaca
atgtttttaagcattgtgttacaggcgattgagacgttgaaagttcatgatatgaatgga
attagtgattatcaacagatgcatcaagtcgacaatgtctatcaggatccccaccagcac
ctaatgcacattcactcggcgccgaattttcacgatgagaatcagaatgccgcgaatttt
cgaaaaacgtcccaacacgcctcgagcctcctctccagtactgcagcagcactaacacaa
caacaacgtcgagcctctcaaagttcaagtacaagtgccggatcttcaattccccatgct
ccaccaccaccagttccacttaccagtaacattccacaggctccaccagctccacctcct
ccaatcggtggtattgctccggtaaatgctcacggagctccaccaccaccaccacttcct
ccagttggtgcaggtgctccaccgccacctccgccacctccaccgccagcacagttgatg
gcctccagtggaacgccgagtctcgcagaacagctgaaaatgagaagtcagcagggcctg
aaagcgacgagtaatggggttaaagctgccgctgcagagcccgagaagcctgctgcgaaa
ggagccggcaatctaatgtccgaattggaggctcaactaaataagcgaaaaatgacacaa
gcgaaatcggatgcagttgattcgaaatcaaatacgagcaatggatcatcggatagcgga
tgtggtacggcgacgtcgacgaatggatgtggatcatcgaatggtggatcggttggatcg
gcggccgccaaaaaatggtctgtttcagatgcaacgaagcccatggatagtccgaagacg
catagaaaacttccatccgcctcatcactattctcacaagaagattcatcatcatcatca
tcatctacgctgacaccttcaaaaccaacaacaaatggaacgtcatcggcgattccgaat
gatctactcgagagactccgcgctgacataatggtcgaaatgcgactggagatgaacaag
ctcgagcaacgaatcgtcgaggccaacgatcgggccgtcgatcgggccgtcgagactatt
ttgaacgcgattggtggccgtcgatag

DBGET integrated database retrieval system