KEGG   Caenorhabditis elegans (nematode): CELE_Y51H4A.3
Entry
CELE_Y51H4A.3     CDS       T00019                                 

Gene name
rho-1
Definition
(RefSeq) Ras-like GTP-binding protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04144  Endocytosis
cel04150  mTOR signaling pathway
cel04310  Wnt signaling pathway
cel04350  TGF-beta signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_Y51H4A.3 (rho-1)
   04350 TGF-beta signaling pathway
    CELE_Y51H4A.3 (rho-1)
   04150 mTOR signaling pathway
    CELE_Y51H4A.3 (rho-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CELE_Y51H4A.3 (rho-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y51H4A.3 (rho-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y51H4A.3 (rho-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_Y51H4A.3 (rho-1)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_Y51H4A.3 (rho-1)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    CELE_Y51H4A.3 (rho-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_Y51H4A.3 (rho-1)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_Y51H4A.3 (rho-1)
  Exosomal proteins of colorectal cancer cells
   CELE_Y51H4A.3 (rho-1)
  Exosomal proteins of bladder cancer cells
   CELE_Y51H4A.3 (rho-1)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    CELE_Y51H4A.3 (rho-1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 178458
NCBI-ProteinID: NP_502959
WormBase: WBGene00004357
Ensembl: WBGene00004357
UniProt: Q22038
LinkDB
Position
IV:complement(join(16483992..16484063,16485797..16486147,16488294..16488428,16488946..16488966))
AA seq 192 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRD
LRSDPQTVRELAKMKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFEKATQAALQ
QKKKKKSKCMIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgcgattagaaagaagttggtgatcgtcggcgacggagcctgcggtaaaacttgc
ctgctcatcgttttctcaaaggatcagttcccagacgtgtatgtgccgactgttttcgag
aattatgttgccgacattgaagttgacggaaagcaggtcgaacttgctctatgggataca
gctggacaagaggactatgatcgtctgcgtccactctcttatccggatactgacgtcatt
ctgatgtgcttctcaattgattcacccgattcactggagaatattccagaaaaatggaca
ccagaagtcaggcatttctgtccaaatgttccgattattttggtcggaaataaacgagat
cttcgtagtgatccacagactgttcgagaattggcaaaaatgaaacaggagcccgtgaag
cctgagcagggacgagcaattgctgagcaaattggagcatttgcatatttggagtgctct
gcgaagactaaggacggaattcgtgaggtattcgagaaggcgacacaggcggcattgcaa
cagaagaagaaaaagaagagcaagtgcatgattttgtaa

DBGET integrated database retrieval system