KEGG   Caenorhabditis elegans (nematode): CELE_Y55D9A.1
Entry
CELE_Y55D9A.1     CDS       T00019                                 

Gene name
efa-6
Definition
(RefSeq) Exchange factor for Arf-6
  KO
K12494  PH and SEC7 domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04144  Endocytosis
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CELE_Y55D9A.1 (efa-6)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y55D9A.1 (efa-6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y55D9A.1 (efa-6)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cel04990]
    CELE_Y55D9A.1 (efa-6)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    CELE_Y55D9A.1 (efa-6)
Domain-containing proteins not elsewhere classified [BR:cel04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   CELE_Y55D9A.1 (efa-6)
SSDB
Motif
Pfam: PH_9 Sec7 PH
Other DBs
NCBI-GeneID: 178217
NCBI-ProteinID: NP_001122818
WormBase: WBGene00013223
Ensembl: WBGene00013223
UniProt: G5EET6
LinkDB
Position
IV:complement(join(12606104..12606289,12606959..12607464,12609868..12610400,12610454..12610637,12610756..12610990,12611295..12611416,12613390..12613623,12614050..12614197,12614570..12614719))
AA seq 765 aa
MAKVASSGAEEALATIDGAPRRNVKKSEAFVMSGDVLISLNRNVSSTYAKLLGDQLPPGT
TVASSIHPHQLSRATASAGVSFPSMNRNGAAAQKLSRLPVSTSQIERRGSLARKTSEESS
PTAIRMLKTAPIERMESTDVEESEEETVMMTTDEKENQKKPNENDDEVMVVDEEQFIDGP
SRSPVYDDVDDDLNGSLDAKDMSNNSHQQSFRSPENYSEKDTPSKHSVVTIDGSGVSNHY
DQDGMFSHVYYSTQDTTPKHGSPSLRKQIFESRTTPNTAASNSSASASPSLHATSESRGA
TGGVSLRSAESSNLNQTAVPSTSTNSVGGEREAAQIARNLYELKNCTSTQVADRLNEQNE
FSFLILVKYLELFQFSTTRIDAALREFLSRVELRGESSARERLLRVFSARYLECNPAIFD
SLDEVHTLTCALLLLNSDLHGPNMGKKMTARDFITNIAHTGCTFKREMLKTLFQSIKDNA
ISLQNSAKNSTANGSVASTSRRQPQQIYEVDPDSVVEYYSGFLMRKYVRETDGGKTPFGR
RSWRMVYARLRGLVLYFDTDEHPKATSRYASLENAVSLHHALAEPAPDYKKKSFVFRVRI
AHGGEILFQTSNQKELQEWCEKINFVAAAFSSPTLPLPVTSKPETAPMPRLPRIPCLAPI
TKQLSTHEARVAELNEMIEIVSQSVSPNQPQQLITDRWVLLSFEKRRYSTYINVLRRSLE
ARKASSATTMNIMMTPTRRQQQNQKPVVSEDRLSYTDAVNGAAAH
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcgaaggtggcgtcgtcgggagccgaagaggcactggccaccattgatggagcccct
cgccggaatgtcaaaaagtccgaggcttttgtaatgtccggtgatgtgctcatttctctt
aatcggaacgtttcgagcacttatgcaaagcttctcggcgaccaactgcctccaggtacc
acagttgcatcgagcattcacccacatcagctgtcaagagccaccgcctctgcgggagtt
tcgtttccatcgatgaatcgaaacggagcggcggcccagaaactgtcaagacttccagtt
tcaacaagccaaatcgaaagacgtggtagtttggcacgaaaaacgtcagaagagtcttca
ccaacagctattcgaatgcttaaaacagctccaattgaacgaatggagagcactgatgta
gaggaaagtgaagaagaaactgtaatgatgactactgatgaaaaagagaatcagaagaaa
ccaaatgaaaatgatgatgaagtgatggttgttgatgaagaacaatttattgacggacca
tcccgttcaccagtttatgatgacgtagatgatgacctgaatggatcattggacgcaaag
gatatgtcaaataattcccatcagcaaagtttcaggtcaccggagaattatagtgaaaag
gacactccgtcgaaacattcagtggtaacaatcgatggaagtggtgttagtaaccattac
gatcaagatggaatgttttcacatgtatactacagtactcaggatactacaccaaaacat
ggatccccatctctacggaaacaaatcttcgaatctagaacgactccaaacacggcggcg
agcaatagttcagcatcagccagtccgtcactccatgcaacttctgaaagtcgaggagcc
actggaggagtatcacttcgatccgccgagagcagtaatctcaatcaaacagccgtaccg
agcacttcaacgaattcggttggcggagaacgagaagctgcacaaattgctcgaaatctg
tatgagttgaagaattgcacatcaacacaggtcgccgatcggctcaacgagcaaaacgag
ttctccttcctgatactcgtcaaatacctcgaactcttccaattctcaacaacacgaatt
gatgcagctcttcgggaattcttgagccgagtagagctccgtggtgaatcatcagctcgt
gaacgtttgctccgagtattttctgctcgatacctggaatgtaatcctgcgatttttgat
agtttggatgaagttcacacgttgacatgtgctcttcttcttttaaattcggatcttcat
ggaccaaatatgggaaagaaaatgacggctcgggattttataacgaatatcgctcataca
gggtgtacttttaaacgggaaatgctcaaaactttgtttcaaagtataaaagataatgcg
atttcactacaaaattcggctaaaaactcgacggcaaatggttcagttgcttcaacatca
agacggcagccacaacaaatatatgaagttgatccagattcagttgtcgaatattatagt
ggatttcttatgcgaaaatatgttagagagactgatggtggaaagactccattcggacgt
cgcagttggagaatggtatacgctcgtcttcgtggactcgttctctactttgacacagat
gaacatccaaaagcaacaagtcgatatgcttcattagaaaatgcagtatcactacatcac
gcactggctgaaccagcacctgattataagaagaaatcatttgtattcagagtacgaatt
gctcacggtggagagattctattccagacaagtaatcagaaagagcttcaagaatggtgt
gagaagattaatttcgttgccgccgcattctcatcgccaacacttccattgccagtcact
tcgaaacctgaaactgcaccgatgccacgacttccacggattccgtgtctcgctccgatt
accaagcagctgagtactcatgaagcacgggttgccgaactaaatgaaatgattgaaatt
gtatcacaatccgtatcacctaatcaaccacagcagctgattaccgatcgatgggtgctt
ttgagtttcgagaaacgacgctacagtacctatatcaacgtactccgacggtcattggaa
gcaagaaaagcgtcttcagcaaccacaatgaacattatgatgacaccaacaagacgtcag
caacagaatcaaaagccagttgtctcggaggatcgtctcagctatacggatgctgttaat
ggagctgctgctcattga

DBGET integrated database retrieval system