KEGG   Cellvibrio sp. PSBB006: CBR65_08245Help
Entry
CBR65_08245       CDS       T04891                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00473  D-Alanine metabolism
cell00550  Peptidoglycan biosynthesis
cell01100  Metabolic pathways
cell01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBR65_08245
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBR65_08245
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CBR65_08245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cell01011]
    CBR65_08245
Enzymes [BR:cell01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CBR65_08245
Peptidoglycan biosynthesis and degradation proteins [BR:cell01011]
 Precursor biosynthesis
  Amino acid ligase
   CBR65_08245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A RimK TTL ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ARU27432
UniProt: A0A1Y0FVD0
LinkDB All DBs
Position
complement(2000150..2001091)
Genome map
AA seq 313 aa AA seqDB search
MQSIHLPIDEALKNRLGRVGVLFGGQSAEREISLQSGTAVINALKEAGIDPVVIDVGENA
ISDIQAAKLDRAFIALHGPGGEDGRIQAVLEYLKIPYTGSDVQSSALAMDKLRSKQLWRG
VGLSTPDFAVLQAHTDWAAVLDNLGGEVMVKPAHEGSSIGMSRVQSATELQAAYQNAAQY
DGSVLVERLITGGEYTVAILDGKALAPIKLETDHRFYDFDAKYLAEDTRYLCPCGLSETK
EKELRELALNAFSALGCRGWGRVDVMADSAQNFYLLEVNTVPGMTSHSLVPMAAKAEGLS
FAQLVIAVLLASL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccatacacttgccgattgatgaggccttaaaaaaccgcttgggtcgtgtgggc
gttttgttcggtggacaatcggcagagcgtgaaatttccttgcaaagcggtacggccgtt
atcaatgcattgaaagaagcaggtattgatccggtggtgattgatgttggcgagaatgca
atcagcgatatacaagcggcaaagctggatcgcgcgtttatcgcgctgcatggccccggt
ggtgaagacggacgaattcaggcggtgttggaatatttaaaaattccgtataccggcagt
gacgtacagtcatcggcactggcaatggataaattgcgcagtaaacaattgtggcgtggt
gtcggattatccacgccggatttcgctgtgttgcaggcacataccgattgggcagccgtg
ctggataatctgggtggcgaagtcatggtgaagccagcccacgaaggttccagtatcggt
atgtcgcgtgtgcaatcagcgacggagctgcaagcggcttatcaaaatgccgcgcaatac
gacggcagtgtgttggttgaacgtttgatcaccggtggcgagtacaccgtggcgattctg
gacggcaaagccctggcgccaattaaactggaaactgaccaccgcttttatgattttgat
gcgaaatatcttgcggaagatacgcgctacctctgcccgtgcggcttgagtgagacgaaa
gaaaaagagctgcgtgaattagcgttaaatgccttcagcgcgctcggttgtcgcggttgg
ggtcgcgtggatgtcatggccgattcggcacagaatttttatttgttggaagtgaatacc
gtgcccggcatgaccagccacagcttggtacccatggctgcaaaagcagaaggtttatct
tttgcgcaattggtcatcgctgtattgctggccagtttgtaa

DBGET integrated database retrieval system