KEGG   Cedecea neteri M006: LH23_06830Help
Entry
LH23_06830        CDS       T03328                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cem  Cedecea neteri M006
Pathway
cem00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LH23_06830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cem02000]
    LH23_06830
Enzymes [BR:cem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH23_06830
Transporters [BR:cem02000]
 Other Transporters
  Pores ion channels [TC:1]
   LH23_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AIR60375
LinkDB All DBs
Position
1445246..1445914
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWMLEELAQPYQIVRYQREPTMLAPEALKKIHPLGKSPVVEDNGH
ILAESGAILEYLQETYDSENRLKPQEINDKIQYRFWLHYAEGSLMPLLLMKLVFGSLGKA
PVPWPLRPVGKALGQGVQKAWLNKQLSTHARFIEDHLSQHPWFAGQQFSAADIQMSFPVA
ALLARGEVNDMPHTQAWMKNVQTRPAWLRALNQGGPFEIPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggtgcatcacctcaataactcccgttcccagcgtgtactttggatgctggaa
gaactggctcagccgtatcagattgtgcgttatcagcgggaacccaccatgcttgccccg
gaagcactaaaaaaaatccatccgctgggtaaatccccggtggtggaagataacggccat
attctggcggaatcaggtgccattcttgagtacctgcaggaaacctacgacagtgaaaac
cgcctgaagccgcaggagattaacgacaaaatccagtatcgcttttggctgcattacgcc
gaagggtcgctgatgccgctgctgttaatgaagctggtgtttggcagcctcggtaaagca
cctgtgccctggccgctgcgcccggtgggcaaggcgctggggcagggcgtgcagaaagcc
tggttgaataagcaactcagcacccatgcccgttttatcgaggatcacctgagccagcac
ccgtggttcgccgggcagcagtttagcgcggcagatattcagatgagtttcccggtggcc
gcgctgctggcgagaggggaagtcaacgacatgccgcacacccaggcgtggatgaaaaac
gtgcaaacgcgccccgcctggctgcgagcgttaaatcaaggcggcccttttgagatccca
ggggcgtga

DBGET integrated database retrieval system