KEGG   Canis lupus familiaris (dog): 403989
Entry
403989            CDS       T01007                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04061  Viral protein interaction with cytokine and cytokine receptor
cfa04151  PI3K-Akt signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04630  JAK-STAT signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04672  Intestinal immune network for IgA production
cfa04940  Type I diabetes mellitus
cfa05135  Yersinia infection
cfa05142  Chagas disease
cfa05162  Measles
cfa05166  Human T-cell leukemia virus 1 infection
cfa05200  Pathways in cancer
cfa05320  Autoimmune thyroid disease
cfa05321  Inflammatory bowel disease
cfa05330  Allograft rejection
cfa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    403989 (IL2)
   04151 PI3K-Akt signaling pathway
    403989 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    403989 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    403989 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    403989 (IL2)
   04660 T cell receptor signaling pathway
    403989 (IL2)
   04658 Th1 and Th2 cell differentiation
    403989 (IL2)
   04659 Th17 cell differentiation
    403989 (IL2)
   04672 Intestinal immune network for IgA production
    403989 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403989 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    403989 (IL2)
   05321 Inflammatory bowel disease
    403989 (IL2)
   05330 Allograft rejection
    403989 (IL2)
   05332 Graft-versus-host disease
    403989 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    403989 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    403989 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    403989 (IL2)
   05162 Measles
    403989 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    403989 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    403989 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    403989 (IL2)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Interleukins
   403989 (IL2)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Cytokines
   403989 (IL2)
SSDB
Motif
Pfam: IL2 Aromatic_hydrox
Other DBs
NCBI-GeneID: 403989
NCBI-ProteinID: NP_001003305
Ensembl: ENSCAFG00000004008
VGNC: 41963
UniProt: Q29416
LinkDB
Position
19
AA seq 155 aa
MYKMQLLSCIALTLVLVANSAPITSSSTKETEQQMEQLLLDLQLLLNGVNNYENPQLSRM
LTFKFYTPKKATEFTHLQCLAEELKNLEEVLGLPQSKNVHLTDTKELISNMNVTLLKLKG
SETSYNCEYDDETATITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcatcgcactgacgcttgtacttgtcgcaaacagt
gcacctattacttcaagctctacaaaggaaacagagcaacagatggagcaattactgctg
gatttacagttgcttttgaatggagttaataattatgagaacccccaactctccaggatg
ctcacatttaagttttacacgcccaagaaggccacagaatttacacaccttcaatgtcta
gcagaagaactcaaaaacctggaggaagtgctaggtttacctcaaagcaaaaacgttcac
ttgacagacaccaaggaattaatcagcaatatgaatgtaacacttctgaaactaaaggga
tctgaaacaagttacaactgtgaatatgatgacgagacagcaaccattacagaatttctg
aacaaatggattaccttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system