KEGG   Canis lupus familiaris (dog): 478047
Entry
478047            CDS       T01007                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    478047 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    478047 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cfa03310]
    478047 (NR3C1)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    478047 (NR3C1)
Nuclear receptors [BR:cfa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   478047 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 478047
NCBI-ProteinID: NP_001289757
Ensembl: ENSCAFG00000006293
VGNC: 43952
UniProt: A0A0A7KLD0
LinkDB
Position
2
AA seq 780 aa
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQ
RLLVDFPKGSGSHAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKSSVSAVSAAPTEKEFAQTLSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDVWRKKLQDLDFTSGSPEKEASESPWRSDLLIDENCLLSPLAGEDDPFL
LEGNSNEDCKPLVLPDTKPKIKDNGDLILASPNSVPLPQVKTEKEDFIELCTPGVIKQEK
LGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPP
IPVGSENWNRCQGSGDDNLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPP
PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
YRKCLQAGMNLEARKTKKKIKGIQQATPGASQETSENPANKTIVPATLPQLTPTLVSLLE
VIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQ
YSWMFLMAFALGWRSYRQSSGSMLCFAPDLIINEQRMTLPCMYDQCKHMLFVSSELQRLQ
VSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQ
LTKLLDSMHDVVENLLNFCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcattaagtccccccagtaaagaagaaatctctagcagtgtgctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctgaggggaggagctactgtg
aaggtttctgcgtcttcaccctcactggctgctgcttctcagtcagactccaagcagcaa
agacttttggttgattttccaaaaggctcaggaagccatgcacagcagccagatctgtcc
aaggcagtttcactctcaatgggattgtatatgggcgagacagaaaccaaagtgatggga
aatgacctgggattcccacaacagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcaaccagtgttccagagaacccc
aagagctcagtgtctgctgtttctgctgcccccacagagaaggagtttgcacaaactctt
tctgatgtgtcttcagaacagcaacatttaaaaggccagacgggcaccaatgggggcaac
gtgaagttgtataccacagaccaaagcacctttgacgtttggaggaaaaaactccaggat
ttggactttacttctgggtccccagagaaagaggcgagtgagagcccttggagatcagac
ctcttgatagatgaaaactgtttgctctctcctttggcaggagaggacgatccattcctt
ctggaaggaaactcgaacgaggactgtaaacctctcgttttgccggacacaaaacctaaa
attaaggataatggagacctgatcttagccagccccaacagtgtgccactgccccaagtg
aaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggagaaa
ctgggcccagtttactgtcaggcaagcttttctggggcaaatataattggtaataaaatg
tctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgacatg
aatacagcatccctttctcaacagcaggatcagaagcctatttttaatgtcattccacca
attcctgttggttcagaaaattggaataggtgccaaggatctggcgatgataacttggct
tccttggggactttgaacttccctggtcggtcggtgttttctaatggctattcaagccct
ggaatgagaccagatgtcagctctcctccatccagctcctcagcggcaacgggaccacct
cccaaactctgcctcgtgtgttctgacgaggcctcggggtgtcattacggggtcttgact
tgtggaagctgcaaagtgttcttcaagagagcggtggaaggacaacacaattatctttgt
gctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagcatgccgc
tatcggaaatgtcttcaagctgggatgaacttggaagctcgaaaaacaaagaaaaagata
aaaggaattcagcaggccactccaggagcatcacaagaaacttctgaaaatcctgctaac
aaaacaatagttcctgcaacattaccacagctcacccctaccctggtgtccctgctggag
gtcattgaacccgaggtgttatacgcagggtatgacagctctgtcccagattcgacttgg
cggatcatgaccacactcaacatgttaggtgggcggcaagtgatcgcagcagtgaaatgg
gccaaggcaataccaggattcaggaacttacacctggatgaccaaatgaccctactgcag
tattcatggatgttcctcatggcatttgccctggggtggagatcatatagacaatcaagt
ggaagcatgctgtgttttgctcctgatctgattattaatgagcagagaatgaccctcccc
tgcatgtatgaccaatgtaaacacatgctgtttgtttcctccgagttacagaggcttcag
gtctcttatgaagagtatctatgtatgaaaaccttactgcttctctcttcagttcctaag
gaaggtttgaagagccaagaactgtttgatgaaattagaatgacctacatcaaagagcta
ggaaaagccattgtcaagagggaagggaactccagccagaactggcaacgcttttatcaa
ctgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaacttttgcttc
caaacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatcatc
accaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaag
tga

DBGET integrated database retrieval system