KEGG   Canis lupus familiaris (dog): 490967
Entry
490967            CDS       T01007                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa04062  Chemokine signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04068  FoxO signaling pathway
cfa04217  Necroptosis
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04630  JAK-STAT signaling pathway
cfa04659  Th17 cell differentiation
cfa04917  Prolactin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04931  Insulin resistance
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04935  Growth hormone synthesis, secretion and action
cfa05145  Toxoplasmosis
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05162  Measles
cfa05163  Human cytomegalovirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
cfa05212  Pancreatic cancer
cfa05221  Acute myeloid leukemia
cfa05223  Non-small cell lung cancer
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfa05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    490967 (STAT3)
   04066 HIF-1 signaling pathway
    490967 (STAT3)
   04068 FoxO signaling pathway
    490967 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    490967 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    490967 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    490967 (STAT3)
   04062 Chemokine signaling pathway
    490967 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    490967 (STAT3)
   04917 Prolactin signaling pathway
    490967 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    490967 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    490967 (STAT3)
   05206 MicroRNAs in cancer
    490967 (STAT3)
   05205 Proteoglycans in cancer
    490967 (STAT3)
   05203 Viral carcinogenesis
    490967 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    490967 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    490967 (STAT3)
   05221 Acute myeloid leukemia
    490967 (STAT3)
   05223 Non-small cell lung cancer
    490967 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    490967 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    490967 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    490967 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    490967 (STAT3)
   05161 Hepatitis B
    490967 (STAT3)
   05160 Hepatitis C
    490967 (STAT3)
   05163 Human cytomegalovirus infection
    490967 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    490967 (STAT3)
   05169 Epstein-Barr virus infection
    490967 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    490967 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    490967 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    490967 (STAT3)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    490967 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR KGG
Other DBs
NCBI-GeneID: 490967
NCBI-ProteinID: XP_005624514
Ensembl: ENSCAFG00000015213
VGNC: 46890
UniProt: E2RB82
LinkDB
Position
9
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQASHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSTMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTSNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFETLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcaactcgacacacggtacttagagcagcttcatcag
ctgtacagcgacagcttcccaatggagctacggcagtttctggccccgtggattgagagt
caagattgggcatatgcagccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagattgaccagcagtacagccgtttcctacaggagtcaaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcagatatctggagaagccaatggag
attgcccgaattgtggcccggtgcttgtgggaagagtcccgcctgctacaaactgcagcc
actgcagctcagcaagggggccaggccagccaccccacagccgccgtggtgacggagaag
caacagatgctggagcagcatcttcaagatgttcggaagcgagtacaggatctagaacag
aaaatgaaagtggtcgagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtcggtgaccagacagaagatg
cagcagctggagcagatgctcactgcactggaccagatgcggcggagcatcgtgagtgag
ttagcggggctgttgtcaactatggagtacgtgcagaaaactctcacggatgaagagctg
gctgattggaagaggcggcaacagattgcgtgcattggaggcccccccaacatctgccta
gatcgcctagaaaactggataacctcattagcagagtcacaacttcagacccgccaacaa
attaagaaactggaggagttacaacaaaaagtgtcctataaaggggatcccatcgtccag
caccggccaatgctagaggagaggattgtagagctgtttaggaacttaatgaaaagtgcc
tttgtggttgagcggcagccttgcatgcccatgcatcctgaccggccgttagtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattcccggagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgtcgcagctctcagagga
tctcggaaatttaacattctgggcacaaacacaaaagtgatgaacatggaagagtccaac
aacggcagcctgtctgcagaattcaaacacctgaccctgagagagcaaagatgtggtaat
gggggccgagccaactgtgatgcctccctgattgtcactgaggagctgcacctgatcacc
tttgagacggaggtgtatcaccaaggcctcaagattgaccttgagacccactccttgcca
gttgtggtgatctcgaatatctgtcagatgccaaatgcctgggcatcaatcctgtggtac
aacatgctgaccagcaaccccaagaacgtgaactttttcaccaagcccccgattggaacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccaccacaaagcgaggactg
agcatcgagcagttgactacgctggcagagaaactcttaggacctggtgtgaactactca
gggtgtcagattacgtgggctaaattttgcaaagaaaacatggctggcaaaggcttctcc
ttctgggtttggctagacaatatcattgacctcgtgaaaaagtatatcctggctctttgg
aatgaaggatacataatgggttttatcagtaaggagcgggagcgggccatcctgagcaca
aagcccccaggcaccttcctgctacggttcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccatat
accaagcaacagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctggtgtctccactggtctatctctaccccgacattcctaaggaa
gaggcatttggaaagtactgtcgaccagagagccaggaacatcctgaagccgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacgtgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggagggcagttcgagaccctcacgttcgacatggag
ttgacctcggagtgcgctacctccccgatgtga

DBGET integrated database retrieval system