KEGG   Citrobacter farmeri: CI104_01420Help
Entry
CI104_01420       CDS       T05012                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00250  Alanine, aspartate and glutamate metabolism
cfar00410  beta-Alanine metabolism
cfar00640  Propanoate metabolism
cfar00650  Butanoate metabolism
cfar01100  Metabolic pathways
cfar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CI104_01420
   00650 Butanoate metabolism
    CI104_01420
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CI104_01420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CI104_01420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfar01007]
    CI104_01420
Enzymes [BR:cfar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CI104_01420
Amino acid related enzymes [BR:cfar01007]
 Aminotransferase (transaminase)
  Class III
   CI104_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AST82164
UniProt: A0A223JYP0
LinkDB All DBs
Position
291191..292456
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGIGVMCGFYAERAENATLWDVEGREVIDFAAGIAVLNTGHRHPN
VIAAIEKQLQSFTHTAYQIVPYESYVRLAERINKRVPIQGPVKTAFFSTGAEAVENAVKI
ARAYTNRPGLITFGGAFHGRTFMTMALTGKVAPYKMGFGPFPGSVYHAQYPNALHGVSTA
DALQSLERIFKADIAPEQVAAIILEPVQGEGGFNIAPTDFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMEHHGVQPDLITMAKSLAGGMPLSAVAGRAGVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEQLCARAAALGAALVDALNQAKADCPFIADIRAQGSMVAVEFND
PHTGKPSPEFTRQVQDRALQEGLLLLSCGVYGNVIRFLYPLTIPEAQFRQALGIITHSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacgaactgaatgaacggcgtttgcaggcgacgccgcgcgggatcggcgtg
atgtgtggcttttacgccgagagagcggaaaacgcaacgttgtgggatgtggagggccgt
gaggtgatcgattttgccgccggtattgcggtgctgaataccgggcatcggcaccccaac
gtgatcgcggctatcgaaaaacagctccagtcctttacccataccgcttaccagattgtt
ccttacgaaagctatgtccggcttgcggaacgcatcaataaacgggtccccattcagggg
ccagtgaaaacggcgttcttctccaccggtgcagaagcggtggaaaatgcggtgaagatt
gcccgcgcgtataccaaccgaccgggactcattaccttcggcggcgcatttcatggtcgg
actttcatgacgatggcgctgaccggtaaggttgcgccctacaaaatgggttttggaccg
tttcctggttcggtttatcacgctcagtaccctaatgcgttacacggcgtgagtaccgcc
gatgcgctgcaaagtctggagcgcattttcaaagcggatatcgcaccggagcaggtcgcc
gccatcatccttgaaccggttcagggcgaagggggattcaatattgcgccaacggatttc
atgcaggccctgcgggcgttgtgcgatacccacggtattttgttgatcgccgatgaggta
cagaccggctttgcccgtaccggcaagctgtttgctatggagcatcatggcgtacagccc
gatctgatcacaatggcgaaaagtctggcgggcggtatgccgctttctgcggtggctggc
cgtgccggggtgatggatgcgcctgcgcctggtggcctgggagggacgtatgccgggaat
cccctggccgttgcggcggcacacgcggtgctggatgtcattgatgaagaacagctctgc
gcccgcgctgccgcattaggcgcggccttggtcgacgcgttgaatcaggcgaaagcggac
tgtccgtttattgccgatatccgtgctcaggggtcgatggtggcggtggaatttaacgat
ccacacaccgggaagccctccccggaattcactcgccaggtgcaggatcgcgccttgcag
gaagggcttctgttgttgagttgcggcgtgtatggcaacgtcatacgttttctctatccg
cttaccatccctgaggcgcaatttcgtcaggcgctcggcattatcacccactcgctgaca
cgataa

DBGET integrated database retrieval system