KEGG   Cellulomonas fimi: Celf_2169Help
Entry
Celf_2169         CDS       T01490                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfi  Cellulomonas fimi
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfi01001]
    Celf_2169
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Celf_2169
Protein kinases [BR:cfi01001]
 Serine/threonine kinases: Other
  Bacterial family
   Celf_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Pkinase_fungal APH Haspin_kinase ABC1 DUF3325
Motif
Other DBs
NCBI-ProteinID: AEE46297
UniProt: F4H1J8
LinkDB All DBs
Position
2407133..2409136
Genome map
AA seq 667 aa AA seqDB search
MGATVTDPLVGRLVDGRYEVVSRIARGGMATVYLAVDRRLDRDVALKVMHPHLAEGTSGS
DFVARFRREARTAARLTHPGLVGVFDQGLDGETSYLTMEYVDGSNLRRRIAERGALSVGE
ALHVTACVLDALAAAHRVGLVHRDIKPENVLLASDERVKLADFGLARAVTEVTSTTTGTV
LGTVAYLAPELVVRGASDARTDVYACGILLYEMLVGAQPFTGETPIQVAFQHVNNDVPPP
SDAVPWLPAEVDELVLALASRSPDDRPVDAAAALALVRRTRAALDEATLARHADVAPSIA
LPAATDPDETDLEDTADEADAGQATTRLATVPPGSTVALPIGLGGSVPSVPVPVVHEPER
PRRRRGRVLALVLALVLALAGAGTWWYLQVGPGAWTTVPTVTALTEDQAREVLDDAGLRA
TAVQAFDATAPAGTVVAAEPAVGEPVRKDGSVELTVSKGPDYVNVPQGVVGKLQAEAEAA
LVAAGLTASYPPAEYHDTVPNGVVISATLPDGSPADPGARTVRDTAVALVVSKGPAPVTV
VSVVNETLDSATATLDGLGLKVATAEAFSDTVEAGHVISQDPADKTELHRGDTVTLTISK
GPELLPVPNVYGTNVKDATKTLQDAGFVVKVAHPQGISPLNMVYSQNPEGGDGKSAPKGS
TVTINVF
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgggagccaccgtcaccgatccgctcgtgggccgcctggtcgacgggcggtacgaggtc
gtgtcccgcatcgcccgcggggggatggcgaccgtctacctggcggtcgaccgccggctg
gaccgggacgtcgccctcaaggtgatgcacccgcacctggcggaggggacgtccgggtcc
gacttcgtcgcgcggttccgccgtgaggcgcgcacggccgcgcggctcacgcacccgggc
ctagtcggggtcttcgaccagggcctcgacggcgagacgagctacctgacgatggagtac
gtcgacggttcgaacctgcgccgtcgcatcgccgaacgcggcgcgctgagcgtcggcgag
gcgctccacgtgaccgcgtgcgtgctcgacgcgctcgccgccgcgcaccgcgtcgggctc
gtgcaccgggacatcaagccggagaacgtgctgctggcctccgacgagcgcgtcaagctc
gcggacttcggcctcgcccgggcggtcacggaggtcacctcgaccacgaccggcaccgtg
ctcgggacggtcgcctacctcgcgccggagctcgtcgtgcgcggcgcgagcgacgcccgg
accgacgtgtacgcgtgcgggatcctgctgtacgagatgctcgtgggcgcccagcccttc
accggcgagacaccgatccaggtcgccttccagcacgtcaacaacgacgtgccgccgccg
tcggacgccgtcccgtggctccctgccgaggtcgacgagctcgtgctcgcgctcgcgtcg
cggtccccggacgaccggcccgtggacgccgcggcagccctggccctcgtccggcgcacg
cgcgccgcgctcgacgaggcgacgctcgcccggcacgcggacgtcgcaccgtcgatcgcc
ctgcccgccgcgaccgaccccgacgagacggacctcgaggacacggccgacgaggccgac
gcgggccaggccacgacgcggctggcgaccgtgccgccggggtcgaccgtcgccctgccg
atcggtctcggcgggtccgtcccgtccgtccccgtgcccgtcgtgcacgagccggaacgc
cctcggcgccgccgcggccgggtgctcgcgctggtcctcgcgctcgtcctcgcgctcgca
ggcgcgggcacgtggtggtacctgcaggtcgggcccggtgcctggaccacggtgcccacc
gtcacggcgctcaccgaggaccaggcgcgcgaggtgctcgacgacgccggcctgagggcc
accgccgtgcaggcgttcgacgcgaccgctccggccggcacggtcgtcgcggcggagccg
gccgtcggcgagcccgtgcgcaaggacggaagcgtcgagctcacggtctccaagggaccg
gactacgtcaacgtcccgcagggcgtcgtcggcaagctgcaggcggaggcggaggcggcg
ctcgtcgcggcgggcctcacggcctcctacccgccggccgagtaccacgacaccgtgccg
aacggcgtcgtcatcagcgcgaccctgcccgacggctcccccgccgaccccggcgcccgg
accgtccgcgacaccgcagtggcgctggtcgtgtccaagggccccgcgcccgtgacggtc
gtctccgtcgtcaacgagacgctcgactcggccaccgcgacgctcgacgggctgggtctc
aaggtcgcgaccgccgaggcgttcagcgacaccgtcgaagccggtcacgtcatctcgcag
gacccggcggacaagacggagctgcaccgcggcgacaccgtcacgctcacgatctcgaag
ggcccggagctgttgcccgtgcccaacgtgtacggcaccaacgtgaaggacgcgacgaag
accctccaggacgcggggttcgtggttaaggtcgcgcatccgcaggggatctcaccgttg
aacatggtctactcgcagaacccagaaggcggggacggcaagtccgcacctaaggggagc
accgtcacgatcaacgtgttctaa

DBGET integrated database retrieval system