KEGG   Camponotus floridanus (Florida carpenter ant): 105249710Help
Entry
105249710         CDS       T03919                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04146  Peroxisome
cfo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105249710
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105249710
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105249710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 105249710
NCBI-ProteinID: XP_011253679
UniProt: E2A8Y6
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MTIKAVCVLQGESVKGTVHFEQADGSSTVKVTGEVSGLQKGLHGFHVHEFGDNTNGCTSA
GAHFNPLGKEHGGPKDSVRHIGDLGNVEAGADGVAKVNITDSQIQLSGPHSVVGRTVVVH
ADPDDLGAGGHELSKTTGNAGARLACGVIGITK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaggcggtctgtgttcttcagggcgaatccgttaagggaaccgtgcacttc
gagcaagcggatggttcaagtacggtgaaagtgactggagaagtttctggcttacagaaa
ggcttgcatggctttcatgttcatgaatttggcgataacactaatggttgtactagtgca
ggtgctcacttcaatcctttgggaaaggagcatggcggtccaaaggattctgtgcgccac
attggagatttaggaaacgtggaagctggtgcagatggtgttgcaaaggtcaacatcact
gactcccagattcagctcagtggaccgcatagtgttgttggacgaactgttgtggttcac
gctgatccggatgatttgggagcgggtggccacgagctctcgaaaacgaccggtaatgct
ggcgctcgtctcgcttgcggcgtcatcggcatcacgaagtaa

DBGET integrated database retrieval system