KEGG   Camelus ferus (Wild Bactrian camel): 102503791
Entry
102503791         CDS       T02979                                 

Definition
(RefSeq) whey acidic protein
  KO
K17106  whey acidic protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102503791
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 102503791
NCBI-ProteinID: XP_006175200
LinkDB
Position
7
AA seq 160 aa
MRCLASLALALLSLEAAFALAPALSLPGQAVCPELSSSEDNACIISCVNDESCPQGTKCC
ARSPCSRSCTVPLMEPVLKDGRCPWVQTPLTAKHCLEKNDCSRDDQCEGNKKCCFSSCAM
RCLDPVTGKRLRDPSPRPPSQPPPFFLPLPAPTVVASARL
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcgctgtcttgccagcctggccctggccctgctctccctggaggctgcctttgcactg
gccccagccctctccttgccagggcaggccgtgtgcccagagctcagctcctccgaggac
aacgcctgcataatctcctgtgtcaacgatgagagctgtccccaaggcaccaagtgctgc
gccaggagcccctgcagccgatcctgcacagtccccctcatggagcctgtcctgaaggat
ggccgctgcccctgggtgcagaccccgctgaccgcaaagcactgtttggagaaaaacgat
tgctccagggacgaccagtgtgagggcaacaagaaatgctgcttcagttcgtgtgccatg
aggtgtctggaccccgtcacaggcaagcgtctcagagacccttctcctaggccaccttcc
cagccaccacccttctttctccctttgcctgcgccgaccgtggtggcctctgcaaggctc
taa

DBGET integrated database retrieval system