KEGG   Camelus ferus (Wild Bactrian camel): 102507692
Entry
102507692         CDS       T02979                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
cfr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102507692 (G6PC2)
   00052 Galactose metabolism
    102507692 (G6PC2)
   00500 Starch and sucrose metabolism
    102507692 (G6PC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102507692 (G6PC2)
   04151 PI3K-Akt signaling pathway
    102507692 (G6PC2)
   04152 AMPK signaling pathway
    102507692 (G6PC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102507692 (G6PC2)
   04922 Glucagon signaling pathway
    102507692 (G6PC2)
   04920 Adipocytokine signaling pathway
    102507692 (G6PC2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102507692 (G6PC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102507692 (G6PC2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102507692 (G6PC2)
SSDB
Motif
Pfam: PAP2 DUF1761
Other DBs
NCBI-GeneID: 102507692
NCBI-ProteinID: XP_006182921
LinkDB
Position
5
AA seq 355 aa
MDFLHRNGVLLIQHLQKDYRAYYSFLNFMSNVGDPRNIFSIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSNPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALGHMVNQMDKLSTTLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEASEHTPSIQSASLSTYLKTNLFLFLFALGLYLLLGLLDIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAIHSEMFLRSCGGETGYGLSFRLLCAGAS
LTTLQLYHFIKIPTHTEYLFYVLSFCKSASIPLTVVALIPYCMHILMKPREKKIN
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcataggaacggcgtgctccttattcagcatttgcagaaggactaccga
gcttactacagttttctaaattttatgtccaatgttggagatccccggaatatattttct
atttattttccactttggtttcaacttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggactggttcaatcttatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaaatccatgccttgaacaa
ttccccactacttgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatcc
tgtgtctggtatgtcatggtgacagctgccctgggccacatggtcaatcagatggataag
ttatctaccactctgcacagactgacctggtcatttctttggagtcttttttggttgatt
caaatcagcgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgcttgtggcagaggcctctgaacacactccaagcatccaa
tcagccagcctgagcacatacctgaagaccaacctcttcctcttcctgtttgcacttggc
ctttacctgcttcttggactgcttgacattgacttgctgtggtctgtgcccattgccaag
aagtggtgtgccaaccccgactggatccacattgacaccacaccctttgccggactcgtg
agaaacctcggggtcctctttggcttgggctttgcaattcactcggagatgttcctgagg
agctgcggaggggaaaccggctacgggctgagcttccggctgctctgcgcgggggcctcg
ttgaccacgctgcagctctaccatttcatcaagatcccaacccacacagagtatttattt
tatgtgctgtctttttgtaaaagtgcatccatcccactgactgtggttgccttgattccc
tactgtatgcatattttaatgaaaccaagagaaaagaagattaattag

KEGG   Camelus ferus (Wild Bactrian camel): 102514181
Entry
102514181         CDS       T02979                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
cfr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102514181 (G6PC)
   00052 Galactose metabolism
    102514181 (G6PC)
   00500 Starch and sucrose metabolism
    102514181 (G6PC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102514181 (G6PC)
   04151 PI3K-Akt signaling pathway
    102514181 (G6PC)
   04152 AMPK signaling pathway
    102514181 (G6PC)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102514181 (G6PC)
   04922 Glucagon signaling pathway
    102514181 (G6PC)
   04920 Adipocytokine signaling pathway
    102514181 (G6PC)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102514181 (G6PC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102514181 (G6PC)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102514181 (G6PC)
SSDB
Motif
Pfam: PAP2 Glt_symporter DUF373
Other DBs
NCBI-GeneID: 102514181
NCBI-ProteinID: XP_006175223
UniProt: S9XCU2
LinkDB
Position
16
AA seq 357 aa
MEEGMNALHDFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVQDTDYYGNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFRHIQSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AKRWCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLGCIV
ASLILLHLFDSLKPPSQTELIFYILSFCKSAAVPLASVSLIPYCLAWVLGQPNKKTL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggaaggaatgaacgctctccatgactttgggatccagtcaacgcgctacctccag
gtgaattaccaggactctcaggattggttcatcctggtgtccgtgatcgcagacctcagg
aatgccttttatgtcctcttccctatctggttccatcttcgagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcggccatactggtgggtccaggacactgactactatggcaacacctccgtgccg
ctgataaagcagttcccggtcacctgtgagactggcccaggaagtccctctggccacgcc
atgggtacagcaggtgtatactatgtgatggtcacatccaccctctctatctttcgggga
aagaaaaagccaacctacagattccggtgcttgaatgtcattttgtggttgggattctgg
gccgtgcagctgaacgtctgtctgtcacgaatctaccttgctgctcattttccccatcaa
gttgttgctggagtcttgtcaggcatcgctgttgctgagactttccgtcacatccagagc
atctacaacgccagcctcaagaaatactttctcattactttcttcctgttcagttttgcc
attggattttacctgctgctaaaggggctgggtgttgacctcctgtggactctagagaaa
gccaagagatggtgtgagcggccagaatgggtccacattgacaccacgccctttgccagc
ctcctcaagaacctgggaaccctctttggcctgggtctggctctcaactccagcatgtac
agggagagctgcaaaggcaaacttagcaagtggttcccattccgcctcggctgcatcgtg
gcctccctcatcctcctgcatctctttgactctttgaaacccccgtcccaaactgagctg
atcttctacatcctgtccttctgcaagagtgcggcggtgccccttgcgtctgtcagtctc
atcccctactgcctcgcctgggtcctgggccagccgaacaagaagactttgtaa

KEGG   Camelus ferus (Wild Bactrian camel): 102514670
Entry
102514670         CDS       T02979                                 

Gene name
G6PC3
Definition
(RefSeq) glucose-6-phosphatase 3 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
cfr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102514670 (G6PC3)
   00052 Galactose metabolism
    102514670 (G6PC3)
   00500 Starch and sucrose metabolism
    102514670 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102514670 (G6PC3)
   04151 PI3K-Akt signaling pathway
    102514670 (G6PC3)
   04152 AMPK signaling pathway
    102514670 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102514670 (G6PC3)
   04922 Glucagon signaling pathway
    102514670 (G6PC3)
   04920 Adipocytokine signaling pathway
    102514670 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102514670 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102514670 (G6PC3)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102514670 (G6PC3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 102514670
NCBI-ProteinID: XP_006174279
LinkDB
Position
16
AA seq 346 aa
MESTLNAGIAMAEALQNQLPWLENVWLWVTFLGDPKNLFLFYFPAAYYSSRRVGIAVLWI
SLITEWLNLVFKWLLFGDRPFWWIHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
AFWPIMTAISSQVATRAHSRWVRVMPSLAYCTFLLAVGLSRVFLLAHFPHQVLAGLITGA
VLGWLMTPRVPMERELSFYGLTSLALLLGASLIYWTLFTLGLDLSWSINLASKWCERPEW
VHLDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAHLGHGQKLACLVLAMGLLGPLDWL
GYPPQISLFYIFNFLKYTLWPCLVLALVPWLVHTFSSQEAPPIRSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccacgctgaacgcgggcatcgcgatggctgaggcgctgcagaaccagctgccc
tggttggagaacgtttggctctgggtcacctttctgggcgaccccaagaacctctttctg
ttctacttccccgcggcctactactcctctcgccgggtgggcatcgcggttctctggatt
agcctcatcaccgagtggctcaacctcgtcttcaagtggctgctgtttggagacaggccc
ttttggtggatccatgagtctgggtactacagccaggctccagcccaggttcaccagttc
ccctcttcttgtgaaactggtccaggcagcccttctggacactgtatgatcacaggagca
gccttctggcccataatgacagccatctcttcccaggtggccactcgggcccacagccgc
tgggtgagggtgatgcctagcctggcttattgcaccttcctcctggcagtcggcctgtcc
cgggtcttcctcttagcacatttccctcaccaggtgttggctggcctaattactggtgct
gtcctaggctggttgatgaccccccgggtacccatggagcgagagcttagcttctacggg
ttgacctcactggccctcttgctgggtgccagcctcatctattggaccctctttacactg
ggcctggatctttcttggtccatcaacctagcctctaagtggtgtgagcggcccgagtgg
gtgcacttggacagccgaccctttgcgtccctgagccgcgactcaggggctgccctgggt
ctgggcatcgccctgcactctccttgctatgctcaggtacggcgggcacacctggggcat
ggccagaagctagcctgccttgtgctagccatggggctgttgggccccctggactggctg
ggctacccacctcagatcagccttttctacatcttcaatttcctcaagtacaccctctgg
ccatgcctggtcctggcccttgtgccctggctggtgcacacattcagttcccaggaagca
ccacccatccgctcgtcctga

DBGET integrated database retrieval system